Os01t0190400-01

Locus

Os01g0190400

Description

Similar to Hexokinase.

Transcript Evidence

AK064011 (DDBJ, Best hit)

Protein Evidence

Q1WM15 (UniProt)

CGSNL Gene Symbol

HXK8

CGSNL Gene Name

HEXOKINASE-8

CGSNL Gene Symbol Synonym(s)

OsHXK8

CGSNL Gene Name Synonym(s)

Hexokinase 8

Literature (PMID)

Manual Curation

Note

GO

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: phosphotransferase activity, alcohol group as acceptor (GO:0016773)

InterPro

Hexokinase (IPR001312)

Hexokinase, N-terminal (IPR022672)

Hexokinase, C-terminal (IPR022673)

KEGG

Os01t0190400-01 (EC:2.7.1.1)

KOME

001-124-G12 (Online Clone Ordering)

RiceXPro Database

AK064011

Oryzabase

9009

Plant Gene Family Database (PGFD)

Os01t0190400-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os01t0190400-01

Transcript

1868 bp

>Os01t0190400-01 Similar to Hexokinase.
AGATGGATCAAAACCGCCACTGAAAGGGATCAACTAAACTACTGATGAAAAAAAGTTGAG
TGCTTTAGACAAAAACACAAAACTTTCACGTGCCTCCCTCCAATCCCAGATTATTTTTCT
ATAGATCGATCGATCGAGCCCCGTGAATGCGATTCTGCGCGCATTTCCGGAGCGTCTTTT
GATCGTGGTTGGGTTTGTCTGAACCGAACTCCAAAGGTCTCGCCTTTCTTGCTCTGAAGC
TTTTCTTTAGCTTTTCGATTCGCCTGTCGGGGACCGGGATCATGGCGGCGGTGGAGGCGG
AGAAGGTGGTGGCGGAGCTGCGGGAGAGGTGCGCGACGCCGGCGTCGCTGCTGCGGGATG
TGGCGGCGGCGATGGCCGGCGAGATGGGCGCCGGCCTGGAGAAGGAGGGTGGGAGCAGGG
TCAAGATGCTGCTCTCCTACGTCGACAAGCTCCCCACTGGGAGAGAGGATGGATTGTTCT
ATGGATTGGACCTAGGAGGAACAAACTTCCGGGTGCTCAAGGTTCATCTTGGTGGCAGCA
AGAAGCATGTCGTCAACTCTGAATCCAGGGAAGTCAGCATCCCACCACACCTGATGTCAG
GGACCTCCTCGGAATTGTTTGGTTTCATTGCTGGGGAATTAGGCAAGTTTGTTGCTGAAG
AGGAGGAGGGTACTGACATGCCAAACGGCAAGAAGAAAGAGCTAGGATTCACCTTCTCTT
TTCCTGTGAGGCAACGATCTGTGGCATCGGGTACCCTTGTCAAGTGGACAAAGGCGTTTT
CCATTGATGATGCAGTAGGTGAAGATGTGGTGGCTGAACTACAAACGGCTATGGTGAAAC
AAGGTCTGGACATGCATGTAGCTGCATTGATTAATGATGCTGTTGGAACATTGGCTGGAG
CAAGATACTACGATGAAGATGTTGTCGCAGGTGTGATATTTGGTACTGGCACAAATGCTG
CATATGTTGAGAAGGCAAATGCTATACCAAAATGGGAAGGGGAGTTGCCCAATTCAGGGG
ATATGGTCATCAATATGGAATGGGGTAATTTCTATTCATCGCATCTTCCAGTTACTGAAT
ACGATGAAGCATTAGACAAGGAAAGCTTAAACCCTGGAGAGCAGATATATGAGAAGTTAA
CATCAGGAATGTATTTAGGTGAAATCGTAAGAAGAGTGCTGCTTAAACTGTCCTTGCAGT
CTGGAATTTTCGGTTCTATAGATAACTCCAAGCTCAAAACTTGTTTCCATCTGCGGACTC
CGCACATTTCTGCAATGCACCATGATGAAACACCTGACCTAAAGATAGTGGCTGAAAAAT
TGCATCAAATCCTAGAGATTACACATACATCCTTAGAGATAAGGAAAATGGTTGTCGAAA
TATGCGATATCGTGGCAAGGAGGGCAGCTCGGCTGGCTGCTGCTGGTGTTGCAGGGATCC
TCATGAAGCTTGGAAGAAATGGCGGCATCAACAATCAGCGCTCGGTCATCGCCATTGATG
GAGGTTTGTTCGAACACTACACCAAATTCAGGGAATGTTTGGAGAGCACGTTGGGTGAGT
TGCTGGGAGAGGAGGCTTCCAAGTCGGTAGCCGTCAAGCACGCGAACGACGGGTCAGGGA
TAGGGGCTGCCCTTATTGCAGCCTCTCAATCTCGATGAAAATTTGCTAGATAAATAGTAG
TATATGCCGTCCATTTTTGCTCTGGAGTGAAAAAAATTATTGAAAAAACCTAGCTTTGTT
GTATGTGCTGCTTGGGCATGGTGGAACTGGAAGCAGTCTGTAACCAAAATGAGGCTTGAT
ATACTGTCGCCCTGCATAGTTGTAACCTGAAATAAAATTGGAACTGCAAAACCTTCATTG
TTACCTAT

CDS

1377 bp

>Os01t0190400-01 Similar to Hexokinase.
ATGGCGGCGGTGGAGGCGGAGAAGGTGGTGGCGGAGCTGCGGGAGAGGTGCGCGACGCCG
GCGTCGCTGCTGCGGGATGTGGCGGCGGCGATGGCCGGCGAGATGGGCGCCGGCCTGGAG
AAGGAGGGTGGGAGCAGGGTCAAGATGCTGCTCTCCTACGTCGACAAGCTCCCCACTGGG
AGAGAGGATGGATTGTTCTATGGATTGGACCTAGGAGGAACAAACTTCCGGGTGCTCAAG
GTTCATCTTGGTGGCAGCAAGAAGCATGTCGTCAACTCTGAATCCAGGGAAGTCAGCATC
CCACCACACCTGATGTCAGGGACCTCCTCGGAATTGTTTGGTTTCATTGCTGGGGAATTA
GGCAAGTTTGTTGCTGAAGAGGAGGAGGGTACTGACATGCCAAACGGCAAGAAGAAAGAG
CTAGGATTCACCTTCTCTTTTCCTGTGAGGCAACGATCTGTGGCATCGGGTACCCTTGTC
AAGTGGACAAAGGCGTTTTCCATTGATGATGCAGTAGGTGAAGATGTGGTGGCTGAACTA
CAAACGGCTATGGTGAAACAAGGTCTGGACATGCATGTAGCTGCATTGATTAATGATGCT
GTTGGAACATTGGCTGGAGCAAGATACTACGATGAAGATGTTGTCGCAGGTGTGATATTT
GGTACTGGCACAAATGCTGCATATGTTGAGAAGGCAAATGCTATACCAAAATGGGAAGGG
GAGTTGCCCAATTCAGGGGATATGGTCATCAATATGGAATGGGGTAATTTCTATTCATCG
CATCTTCCAGTTACTGAATACGATGAAGCATTAGACAAGGAAAGCTTAAACCCTGGAGAG
CAGATATATGAGAAGTTAACATCAGGAATGTATTTAGGTGAAATCGTAAGAAGAGTGCTG
CTTAAACTGTCCTTGCAGTCTGGAATTTTCGGTTCTATAGATAACTCCAAGCTCAAAACT
TGTTTCCATCTGCGGACTCCGCACATTTCTGCAATGCACCATGATGAAACACCTGACCTA
AAGATAGTGGCTGAAAAATTGCATCAAATCCTAGAGATTACACATACATCCTTAGAGATA
AGGAAAATGGTTGTCGAAATATGCGATATCGTGGCAAGGAGGGCAGCTCGGCTGGCTGCT
GCTGGTGTTGCAGGGATCCTCATGAAGCTTGGAAGAAATGGCGGCATCAACAATCAGCGC
TCGGTCATCGCCATTGATGGAGGTTTGTTCGAACACTACACCAAATTCAGGGAATGTTTG
GAGAGCACGTTGGGTGAGTTGCTGGGAGAGGAGGCTTCCAAGTCGGTAGCCGTCAAGCAC
GCGAACGACGGGTCAGGGATAGGGGCTGCCCTTATTGCAGCCTCTCAATCTCGATGA

Protein

459 aa

>Os01t0190400-01 Similar to Hexokinase.
MAAVEAEKVVAELRERCATPASLLRDVAAAMAGEMGAGLEKEGGSRVKMLLSYVDKLPTG
REDGLFYGLDLGGTNFRVLKVHLGGSKKHVVNSESREVSIPPHLMSGTSSELFGFIAGEL
GKFVAEEEEGTDMPNGKKKELGFTFSFPVRQRSVASGTLVKWTKAFSIDDAVGEDVVAEL
QTAMVKQGLDMHVAALINDAVGTLAGARYYDEDVVAGVIFGTGTNAAYVEKANAIPKWEG
ELPNSGDMVINMEWGNFYSSHLPVTEYDEALDKESLNPGEQIYEKLTSGMYLGEIVRRVL
LKLSLQSGIFGSIDNSKLKTCFHLRTPHISAMHHDETPDLKIVAEKLHQILEITHTSLEI
RKMVVEICDIVARRAARLAAAGVAGILMKLGRNGGINNQRSVIAIDGGLFEHYTKFRECL
ESTLGELLGEEASKSVAVKHANDGSGIGAALIAASQSR*

5'UTR

chr01:4822849..4823129 (- strand) : 281 bp

CDS

chr01:4822670..4822848 (- strand) : 179 bp

chr01:4822374..4822524 (- strand) : 151 bp

chr01:4822072..4822254 (- strand) : 183 bp

chr01:4821735..4821809 (- strand) : 75 bp

chr01:4821484..4821639 (- strand) : 156 bp

chr01:4821244..4821342 (- strand) : 99 bp

chr01:4821018..4821148 (- strand) : 131 bp

chr01:4820759..4820840 (- strand) : 82 bp

chr01:4820365..4820685 (- strand) : 321 bp

3'UTR

chr01:4820155..4820364 (- strand) : 210 bp

FASTA

>Os01t0190400-01 class=Sequence position=chr01:4820155..4823129 (- strand)
AGATGGATCA AAACCGCCAC TGAAAGGGAT CAACTAAACT ACTGATGAAA AAAAGTTGAG TGCTTTAGAC AAAAACACAA
AACTTTCACG TGCCTCCCTC CAATCCCAGA TTATTTTTCT ATAGATCGAT CGATCGAGCC CCGTGAATGC GATTCTGCGC
GCATTTCCGG AGCGTCTTTT GATCGTGGTT GGGTTTGTCT GAACCGAACT CCAAAGGTCT CGCCTTTCTT GCTCTGAAGC
TTTTCTTTAG CTTTTCGATT CGCCTGTCGG GGACCGGGAT CATGGCGGCG GTGGAGGCGG AGAAGGTGGT GGCGGAGCTG
CGGGAGAGGT GCGCGACGCC GGCGTCGCTG CTGCGGGATG TGGCGGCGGC GATGGCCGGC GAGATGGGCG CCGGCCTGGA
GAAGGAGGGT GGGAGCAGGG TCAAGATGCT GCTCTCCTAC GTCGACAAGC TCCCCACTGG GTCAGTCAGT ATACCTGCAT
ATGCATCGCC TCCTCTGAAT TCTGAATTTC TGATTTGTGT TCATAGCGTC AGAAACAAGA GTGACAGTAG ATACATCTCT
GAAAATGATG GGTTTACACT GATCAGTTTT GTGCCACGAA TTCAGGAGAG AGGATGGATT GTTCTATGGA TTGGACCTAG
GAGGAACAAA CTTCCGGGTG CTCAAGGTTC ATCTTGGTGG CAGCAAGAAG CATGTCGTCA ACTCTGAATC CAGGGAAGTC
AGCATCCCAC CACACCTGAT GTCAGGGACC TCCTCGGTGG GTTTTTGTAC GCTGAATCAT CATCATTTGA CCGAGTTTTG
CTCCATTTTG ATGTTGTTCC ACTGTTGTGC ATTTTTTTAT TTGACGATAT TCGTTGTTTT ACTATATGTC TGCAGGAATT
GTTTGGTTTC ATTGCTGGGG AATTAGGCAA GTTTGTTGCT GAAGAGGAGG AGGGTACTGA CATGCCAAAC GGCAAGAAGA
AAGAGCTAGG ATTCACCTTC TCTTTTCCTG TGAGGCAACG ATCTGTGGCA TCGGGTACCC TTGTCAAGTG GACAAAGGCG
TTTTCCATTG ATGATGCAGT AAGGCGTCCT TCATAAACTC AACATGCATC GCATACATTT TTTGTGGTGA TGTAAAAAAT
AGTCCTAATT AGTAACTACA GCTCTGCAAA ACCCATTATT TATATGAACA TCTTGCGATA TGAACGTTGT TCTAGTCACA
AGCCTTGTCA TTAATACTTG CTAGCTCTTA CTAGTAGATC AGTTTCACGC AAACAAAATA TCCATTTTTA AGCTGATATG
AGTGAATCTT CTATCAGATA AAACATTTCT CTGAAATCAG GTAGGTGAAG ATGTGGTGGC TGAACTACAA ACGGCTATGG
TGAAACAAGG TCTGGACATG CATGTAGCTG CATTGGTGAG TATTGACTGG CTTTTACCTT TCATAAACAT AATATATCTA
CAATGTCAGG TAAACATTTT TAGTCTGAGA GAACTTTTTT GATGAAATAG ATTAATGATG CTGTTGGAAC ATTGGCTGGA
GCAAGATACT ACGATGAAGA TGTTGTCGCA GGTGTGATAT TTGGTACTGG CACAAATGCT GCATATGTTG AGAAGGCAAA
TGCTATACCA AAATGGGAAG GGGAGTTGCC CAATTCAGGG GATATGGTAA GGGACAAAGG CCATACTCCC ACCTTCCATT
GAAATTTAAG CAATAAATTA ACTCACATAA GTTTATTTTA CTCAACTTTT TTGTTGTATC TTTATTCAAT TTCTAAGTTT
TTTTTAAGTG CGTTTATCGT ATTTCAGGTC ATCAATATGG AATGGGGTAA TTTCTATTCA TCGCATCTTC CAGTTACTGA
ATACGATGAA GCATTAGACA AGGAAAGCTT AAACCCTGGA GAGCAGGCAA GTTTCTTCAG CAAAAGACCA CCTACCCTGC
ATGCCTGTAC TGTTGGATCT TGGGTCTTGG CTCAACCATA TAGTTTTGTT TTCTTTTTCA GATATATGAG AAGTTAACAT
CAGGAATGTA TTTAGGTGAA ATCGTAAGAA GAGTGCTGCT TAAACTGTCC TTGCAGTCTG GAATTTTCGG TTCTATAGAT
AACTCCAAGC TCAAAACTTG TTTCCATCTG CGGTATGTCA TTTCCTTTTG TTTTCACAAT TAGCGCTCTT ATGCAATTCA
GGATTGAGTA GGTTGCTTTC AAATGCAGCC CATATGATAT GAATGCTCAT AAGACTGTTT TATAAAGTGT AGAAAATTCT
ATAACAGATT CAAGGCTGAC CCTAAAATAT CCGTTAATGT GGCGAACAGG ACTCCGCACA TTTCTGCAAT GCACCATGAT
GAAACACCTG ACCTAAAGAT AGTGGCTGAA AAATTGCATC AAATCCTAGA GGTATCCATG CTTCTGAAAA AGCTCATATT
CTGCATGTGT ATTCTCTGTA GTGACATGGT ATGTATGCCT GCAGATTACA CATACATCCT TAGAGATAAG GAAAATGGTT
GTCGAAATAT GCGATATCGT GGCAAGGAGG GCAGCTCGGC TGGCTGCTGC TGGTGTTGCA GGGATCCTCA TGAAGCTTGG
AAGAAATGGC GGCATCAACA ATCAGCGCTC GGTCATCGCC ATTGATGGAG GTTTGTTCGA ACACTACACC AAATTCAGGG
AATGTTTGGA GAGCACGTTG GGTGAGTTGC TGGGAGAGGA GGCTTCCAAG TCGGTAGCCG TCAAGCACGC GAACGACGGG
TCAGGGATAG GGGCTGCCCT TATTGCAGCC TCTCAATCTC GATGAAAATT TGCTAGATAA ATAGTAGTAT ATGCCGTCCA
TTTTTGCTCT GGAGTGAAAA AAATTATTGA AAAAACCTAG CTTTGTTGTA TGTGCTGCTT GGGCATGGTG GAACTGGAAG
CAGTCTGTAA CCAAAATGAG GCTTGATATA CTGTCGCCCT GCATAGTTGT AACCTGAAAT AAAATTGGAA CTGCAAAACC
TTCATTGTTA CCTAT