Os01t0208700-01

Locus

Os01g0208700

Description

Similar to Phosphoenolpyruvate carboxylase (Fragment).

Transcript Evidence

AK066635 (DDBJ, Best hit)

Protein Evidence

F1T2K9 (UniProt)

CGSNL Gene Symbol

_

CGSNL Gene Name

_

CGSNL Gene Symbol Synonym(s)

PEPC-2

CGSNL Gene Name Synonym(s)

PEP carboxylase 2, Phosphoenolpyruvate carboxylase 2

Literature (PMID)

Manual Curation

Note

GO

Biological Process: tricarboxylic acid cycle (GO:0006099)

Biological Process: carbon fixation (GO:0015977)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: phosphoenolpyruvate carboxylase activity (GO:0008964)

InterPro

Pyruvate/Phosphoenolpyruvate kinase (IPR015813)

Phosphoenolpyruvate carboxylase, active site (IPR018129)

Phosphoenolpyruvate carboxylase (IPR021135)

KEGG

Os01t0208700-01 (EC:4.1.1.31)

KOME

J013071A07 (Online Clone Ordering)

RiceXPro Database

AK066635

Oryzabase

11420

Plant Gene Family Database (PGFD)

Os01t0208700-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os01t0208700-01

Transcript

3494 bp

>Os01t0208700-01 Similar to Phosphoenolpyruvate carboxylase (Fragment).
AGCAGCCGGTGACACCACAAAATCCTCTCGCGCTCTCGCTCGCGTCTCCTCCCCCTCCCC
CACTCCAACGCTTTAAAAAAACCGGGGGAAATGGCGTGCCCGCGCCTACGCCTCGCCGTG
CAGCCGCGCGCGCGGTATAAATTCGCACGCGAGCCGCGATGATCTCCCTCCACTCCGCCC
CCTTCACCCTCCTCGTAAAGCTCCCCGGCCGGAGGAGGAGCGGTCTTACGCCGCCGAGGT
GCGCCGTCCGGGGAGCCGGGAACGTGTCGTCGGCGGCGGTGCGGGAGATGGCGGTCGCGG
AGGGGCGGCGGCAGCATGAGTACTCCATCGACGCACGCCTCCGGCAGCTCGCGCCGGAGA
AGGTGTCCGCCGACGACCGCCTCGTCGACTACGAGACCCTCCTCGTCGCGCGCTTCCTCG
ACATCCTCGAGGACCTCCACGGCGGCGACTTCAGACAAGTGGTGGAGGATTGCCTGAGGC
TGTCCGGGgagtaccagagcgagggcgacccggcgaggctgggcgagctgggcggcctcc
tgacgagcctggacgtgggcgacgccatcatggtggcgagctccttctcccacatgctca
acctggccaacctcgccgaggagatccagatggtgtaccgcaagaaggcggaggcgagcc
ggcgcggggacttcgtcgacgaggcctccgcgcccaccgagtccgacatcgacgagacgt
tccagcgcctcgtccgcggccttggcaagtccccccgcgaggtgttcgatgcgctccgca
gccagaccatcgacctcgtcctcaccgccCACCCCACGCAGTCCGTCAGGCGTTCACTCC
TCCAGAAGCACGCAAGCATTAGGAGCTGCCTGACACAGCTCTGCGGCGAGGGCATCTCCG
ACAACGAGGAGCAGGAGATCGACGAGGCCCTTCAGAGAGAGATTCTCGCGGCGTTCAAGA
CGGACGAGATCCGGCGGACGCCGCCGACGCCGCAGGACGAGATGCGCGCCGGGATGAGCT
ACTTCCACGACACCATCTGGAACGGCGTGCCCAAGTTCCTCCGGCGCGTCGACACAGCGC
TCAAGAACATCGGCATCGACGAGCGCCTCCCCTACAACGCCCCCCTCATCCAGTTCTCCT
CATGGATGGGCGGCGATCGCGACGGGAATCCGAGGGTTACACCAGAGGTTACCAGGGACG
TGTGCCTGCTTGCCAGGATGATGGCTGCCAACATGTACTTCTCCAAGATGGCCGATTTGA
TGTTCGAGCTCTCCATGTGGCGCTGCAACGACGAGCTCCGAGCTCGTGCCAACGAGTTGC
ACCGGAAGTCCTCAAGGAAGTACGCCAAATACTACATTGAGTTTTGGAAGAAGATTTCTC
CAGGAGAACCTTACCGCATTATACTCGGCGATGTGAGGGACAAGCTGTACAACACCTGCG
AGCGTGCTCGCCAGATCTTGTCGAAGGGAATTTCTAGCATTCCTGAAGACCAGACTTACA
CCAATGTCGAGCAGTTCTTGGAGCCGCTTGAGCTGTGCTACCGATCGCTGTGCGACTGCG
GCGACAAGCTGATCGCCGACGGCAGACTGCTCGACTTAATGCGGCAGGTCTCCACCTTCG
GCCTCTCCCTCGTCAAGCTCGACATCCGGCAGGAGTCGGAGCGCCACACCGACGCCATGG
ACGCGATCACCACGCACCTCGGCATCGGCTCCTACCGGGAGTGGCCCGAGGAGCGGCGCC
AGGAGTGGCTCGTCTCCGAGCTCCGCGGCAGGCGCCCGCTCTTCGGCCCCGACCTGCCGC
AGTCCGAGGAGGTCGCCGACGTGCTCGGCGCGTTCCGGGTCATCGCCGAGCTCCCCGCCG
ACAGCTTCGGCGCGTACATTATCTCCATGGCCACCGCGCCGTCCGACGTGCTCGCCGTCG
AGCTGCTGCAGCGGGAGTGCGGCGTCAAGAAGCCCCTGAGGGTCGTCCCGCTGTTCGAGA
AGCTCGCCGACCTTCAGCAGGCGCGCGCCACCATGGAGCTCCTCTTCTCCGTCGACTGGT
ACAAGGAGCGGATCGACGGGAAGCAGGAGATCATGATCGGGTACTCCGACTCCGGCAAGG
ACGCCGGCCGGCTGTCCGCGGCGTGGCAGCTGTACAAGGCCCAGGAGGAGATCGTCGGCG
TGGCGGAGCGGCACGGCGTGAAGCTGACCATCTTCCACGGCCGGGGCGGCACCGTGGGGC
GCGGCGGCGGGCCGAGCCACCTCGCCATCCTGTCCCAGCCGCCGAACACCGTCAATGGCT
CGCTCCGCGTGACTGTCCAGGGCGAGGTCATCGAGAAGTCGTTCGGCGAGGAGAACCTCT
GCTTCCGGACGCTGCAGAGGTTCACGGCGGCGACCCTGGAGCACGGCATGAACCCGCCGG
TGTCCCCGAAGCCCGAGTGGCGCCGCCTGCTCGACGACATGGCGACGGTGGCCACTGACG
AGTACCGCTCCATCGTGTTCCAGGAGCCGCGCTTCGTGGAGTACTTCCGCGCCGCCACGC
CGGAGACGGAGTACGGGCGGATGAACATCGGCAGCCGGCCGTCGAAGCGGAAGCCCGGCG
GCGGCATCGAGTCGCTGCGCGCCATCCCGTGGATCTTCGCGTGGACGCAGACGCGGTTCC
ACCTCCCCGTGTGGCTGGGCTTCGGCGCCGCGTTCAGGCACGCCATGCAGCAGAGCGACG
CCGGCGGCGGCCTCGCCACGCTCCGCGAGATGTACGACGAGTGGCCCTTCTTCCGCGTCA
CCATCGACCTCCTCGAGATGGTCTTCGCCAAGGGCGACCCCGGCATCGCCGCACTCTACG
ACGAGCTCCTCGTCCCCGACGACCTACGTCCATTCGGCGAGCAGCTCAGAGCCAACTACG
TCGAGACACAGCGCCTGCTCCTGCAAGTTGCTGGGCACAAGGATCTCCTGGAGAGTGATC
CGTACCTGAGGCAGCGGCTGATGCTGCGGGACTCGTACATCACGGCGCTGAACGTGTGCC
AGGCGTACACGCTGAAGCGGATCCGGGACGGCGGGTTCAGGCCGGAGACGCGGCCGCCGC
TGTCGAAGGAGCTTCTGGGCTCGTCGGCGGTGGCGGAGAAGCTGGTGAAGCTCAACCCAA
ACAGCGAGTACGACCCCGGGCTGGAGGACACGCTCATCCTCACCATGAAGGGCATCGCCG
CCGGCATGCAGAACACGGGCTGATCGATGCAAAAGCACCATGGCCTTGCCGGTTAAAACT
TTGTAGAGAAGATTGGTGGGAGTGGATTGAGACTGTAAATTGGTGTTGCTGACTTGTTTC
TGGTGCTTATTGGGTCAAGAACAGATCGTACTGTTCTTGTTTCTTCAGTTATCTCTGTTT
TTTAGCAGTGATGGTACACGGATTTCCTGGTTCTAGCTTGAACCGTGATCACTGTTTTCT
TTCAGTAACGTAGCAGATTAACCTGGAGTGGGGATATACCTGAGAATTCAGCTTCCCAAG
CATATCTTTTTTTG

CDS

3045 bp

>Os01t0208700-01 Similar to Phosphoenolpyruvate carboxylase (Fragment).
ATGATCTCCCTCCACTCCGCCCCCTTCACCCTCCTCGTAAAGCTCCCCGGCCGGAGGAGG
AGCGGTCTTACGCCGCCGAGGTGCGCCGTCCGGGGAGCCGGGAACGTGTCGTCGGCGGCG
GTGCGGGAGATGGCGGTCGCGGAGGGGCGGCGGCAGCATGAGTACTCCATCGACGCACGC
CTCCGGCAGCTCGCGCCGGAGAAGGTGTCCGCCGACGACCGCCTCGTCGACTACGAGACC
CTCCTCGTCGCGCGCTTCCTCGACATCCTCGAGGACCTCCACGGCGGCGACTTCAGACAA
GTGGTGGAGGATTGCCTGAGGCTGTCCGGGgagtaccagagcgagggcgacccggcgagg
ctgggcgagctgggcggcctcctgacgagcctggacgtgggcgacgccatcatggtggcg
agctccttctcccacatgctcaacctggccaacctcgccgaggagatccagatggtgtac
cgcaagaaggcggaggcgagccggcgcggggacttcgtcgacgaggcctccgcgcccacc
gagtccgacatcgacgagacgttccagcgcctcgtccgcggccttggcaagtccccccgc
gaggtgttcgatgcgctccgcagccagaccatcgacctcgtcctcaccgccCACCCCACG
CAGTCCGTCAGGCGTTCACTCCTCCAGAAGCACGCAAGCATTAGGAGCTGCCTGACACAG
CTCTGCGGCGAGGGCATCTCCGACAACGAGGAGCAGGAGATCGACGAGGCCCTTCAGAGA
GAGATTCTCGCGGCGTTCAAGACGGACGAGATCCGGCGGACGCCGCCGACGCCGCAGGAC
GAGATGCGCGCCGGGATGAGCTACTTCCACGACACCATCTGGAACGGCGTGCCCAAGTTC
CTCCGGCGCGTCGACACAGCGCTCAAGAACATCGGCATCGACGAGCGCCTCCCCTACAAC
GCCCCCCTCATCCAGTTCTCCTCATGGATGGGCGGCGATCGCGACGGGAATCCGAGGGTT
ACACCAGAGGTTACCAGGGACGTGTGCCTGCTTGCCAGGATGATGGCTGCCAACATGTAC
TTCTCCAAGATGGCCGATTTGATGTTCGAGCTCTCCATGTGGCGCTGCAACGACGAGCTC
CGAGCTCGTGCCAACGAGTTGCACCGGAAGTCCTCAAGGAAGTACGCCAAATACTACATT
GAGTTTTGGAAGAAGATTTCTCCAGGAGAACCTTACCGCATTATACTCGGCGATGTGAGG
GACAAGCTGTACAACACCTGCGAGCGTGCTCGCCAGATCTTGTCGAAGGGAATTTCTAGC
ATTCCTGAAGACCAGACTTACACCAATGTCGAGCAGTTCTTGGAGCCGCTTGAGCTGTGC
TACCGATCGCTGTGCGACTGCGGCGACAAGCTGATCGCCGACGGCAGACTGCTCGACTTA
ATGCGGCAGGTCTCCACCTTCGGCCTCTCCCTCGTCAAGCTCGACATCCGGCAGGAGTCG
GAGCGCCACACCGACGCCATGGACGCGATCACCACGCACCTCGGCATCGGCTCCTACCGG
GAGTGGCCCGAGGAGCGGCGCCAGGAGTGGCTCGTCTCCGAGCTCCGCGGCAGGCGCCCG
CTCTTCGGCCCCGACCTGCCGCAGTCCGAGGAGGTCGCCGACGTGCTCGGCGCGTTCCGG
GTCATCGCCGAGCTCCCCGCCGACAGCTTCGGCGCGTACATTATCTCCATGGCCACCGCG
CCGTCCGACGTGCTCGCCGTCGAGCTGCTGCAGCGGGAGTGCGGCGTCAAGAAGCCCCTG
AGGGTCGTCCCGCTGTTCGAGAAGCTCGCCGACCTTCAGCAGGCGCGCGCCACCATGGAG
CTCCTCTTCTCCGTCGACTGGTACAAGGAGCGGATCGACGGGAAGCAGGAGATCATGATC
GGGTACTCCGACTCCGGCAAGGACGCCGGCCGGCTGTCCGCGGCGTGGCAGCTGTACAAG
GCCCAGGAGGAGATCGTCGGCGTGGCGGAGCGGCACGGCGTGAAGCTGACCATCTTCCAC
GGCCGGGGCGGCACCGTGGGGCGCGGCGGCGGGCCGAGCCACCTCGCCATCCTGTCCCAG
CCGCCGAACACCGTCAATGGCTCGCTCCGCGTGACTGTCCAGGGCGAGGTCATCGAGAAG
TCGTTCGGCGAGGAGAACCTCTGCTTCCGGACGCTGCAGAGGTTCACGGCGGCGACCCTG
GAGCACGGCATGAACCCGCCGGTGTCCCCGAAGCCCGAGTGGCGCCGCCTGCTCGACGAC
ATGGCGACGGTGGCCACTGACGAGTACCGCTCCATCGTGTTCCAGGAGCCGCGCTTCGTG
GAGTACTTCCGCGCCGCCACGCCGGAGACGGAGTACGGGCGGATGAACATCGGCAGCCGG
CCGTCGAAGCGGAAGCCCGGCGGCGGCATCGAGTCGCTGCGCGCCATCCCGTGGATCTTC
GCGTGGACGCAGACGCGGTTCCACCTCCCCGTGTGGCTGGGCTTCGGCGCCGCGTTCAGG
CACGCCATGCAGCAGAGCGACGCCGGCGGCGGCCTCGCCACGCTCCGCGAGATGTACGAC
GAGTGGCCCTTCTTCCGCGTCACCATCGACCTCCTCGAGATGGTCTTCGCCAAGGGCGAC
CCCGGCATCGCCGCACTCTACGACGAGCTCCTCGTCCCCGACGACCTACGTCCATTCGGC
GAGCAGCTCAGAGCCAACTACGTCGAGACACAGCGCCTGCTCCTGCAAGTTGCTGGGCAC
AAGGATCTCCTGGAGAGTGATCCGTACCTGAGGCAGCGGCTGATGCTGCGGGACTCGTAC
ATCACGGCGCTGAACGTGTGCCAGGCGTACACGCTGAAGCGGATCCGGGACGGCGGGTTC
AGGCCGGAGACGCGGCCGCCGCTGTCGAAGGAGCTTCTGGGCTCGTCGGCGGTGGCGGAG
AAGCTGGTGAAGCTCAACCCAAACAGCGAGTACGACCCCGGGCTGGAGGACACGCTCATC
CTCACCATGAAGGGCATCGCCGCCGGCATGCAGAACACGGGCTGA

Protein

1015 aa

>Os01t0208700-01 Similar to Phosphoenolpyruvate carboxylase (Fragment).
MISLHSAPFTLLVKLPGRRRSGLTPPRCAVRGAGNVSSAAVREMAVAEGRRQHEYSIDAR
LRQLAPEKVSADDRLVDYETLLVARFLDILEDLHGGDFRQVVEDCLRLSGEYQSEGDPAR
LGELGGLLTSLDVGDAIMVASSFSHMLNLANLAEEIQMVYRKKAEASRRGDFVDEASAPT
ESDIDETFQRLVRGLGKSPREVFDALRSQTIDLVLTAHPTQSVRRSLLQKHASIRSCLTQ
LCGEGISDNEEQEIDEALQREILAAFKTDEIRRTPPTPQDEMRAGMSYFHDTIWNGVPKF
LRRVDTALKNIGIDERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAANMY
FSKMADLMFELSMWRCNDELRARANELHRKSSRKYAKYYIEFWKKISPGEPYRIILGDVR
DKLYNTCERARQILSKGISSIPEDQTYTNVEQFLEPLELCYRSLCDCGDKLIADGRLLDL
MRQVSTFGLSLVKLDIRQESERHTDAMDAITTHLGIGSYREWPEERRQEWLVSELRGRRP
LFGPDLPQSEEVADVLGAFRVIAELPADSFGAYIISMATAPSDVLAVELLQRECGVKKPL
RVVPLFEKLADLQQARATMELLFSVDWYKERIDGKQEIMIGYSDSGKDAGRLSAAWQLYK
AQEEIVGVAERHGVKLTIFHGRGGTVGRGGGPSHLAILSQPPNTVNGSLRVTVQGEVIEK
SFGEENLCFRTLQRFTAATLEHGMNPPVSPKPEWRRLLDDMATVATDEYRSIVFQEPRFV
EYFRAATPETEYGRMNIGSRPSKRKPGGGIESLRAIPWIFAWTQTRFHLPVWLGFGAAFR
HAMQQSDAGGGLATLREMYDEWPFFRVTIDLLEMVFAKGDPGIAALYDELLVPDDLRPFG
EQLRANYVETQRLLLQVAGHKDLLESDPYLRQRLMLRDSYITALNVCQAYTLKRIRDGGF
RPETRPPLSKELLGSSAVAEKLVKLNPNSEYDPGLEDTLILTMKGIAAGMQNTG*

5'UTR

chr01:5899561..5899718 (+ strand) : 158 bp

CDS

chr01:5899719..5900021 (+ strand) : 303 bp

chr01:5900124..5900518 (+ strand) : 395 bp

chr01:5900619..5900703 (+ strand) : 85 bp

chr01:5900810..5901032 (+ strand) : 223 bp

chr01:5901131..5901234 (+ strand) : 104 bp

chr01:5901531..5901621 (+ strand) : 91 bp

chr01:5906914..5907068 (+ strand) : 155 bp

chr01:5907241..5908632 (+ strand) : 1392 bp

chr01:5908973..5909269 (+ strand) : 297 bp

3'UTR

chr01:5909270..5909560 (+ strand) : 291 bp

FASTA

>Os01t0208700-01 class=Sequence position=chr01:5899561..5909560 (+ strand)
AGCAGCCGGT GACACCACAA AATCCTCTCG CGCTCTCGCT CGCGTCTCCT CCCCCTCCCC CACTCCAACG CTTTAAAAAA
ACCGGGGGAA ATGGCGTGCC CGCGCCTACG CCTCGCCGTG CAGCCGCGCG CGCGGTATAA ATTCGCACGC GAGCCGCGAT
GATCTCCCTC CACTCCGCCC CCTTCACCCT CCTCGTAAAG CTCCCCGGCC GGAGGAGGAG CGGTCTTACG CCGCCGAGGT
GCGCCGTCCG GGGAGCCGGG AACGTGTCGT CGGCGGCGGT GCGGGAGATG GCGGTCGCGG AGGGGCGGCG GCAGCATGAG
TACTCCATCG ACGCACGCCT CCGGCAGCTC GCGCCGGAGA AGGTGTCCGC CGACGACCGC CTCGTCGACT ACGAGACCCT
CCTCGTCGCG CGCTTCCTCG ACATCCTCGA GGACCTCCAC GGCGGCGACT TCAGACAAGT GGTACGGAAA CCCACTCAAT
TTCTTCTCGT TTGATCGTGT CGATGTGCTG CTCTGCACTG CGAGAATGAC GAGGATTTAA CGGCGCCATG TATGGCGGCG
TAGGTGGAGG ATTGCCTGAG GCTGTCCGGG gagtaccaga gcgagggcga cccggcgagg ctgggcgagc tgggcggcct
cctgacgagc ctggacgtgg gcgacgccat catggtggcg agctccttct cccacatgct caacctggcc aacctcgccg
aggagatcca gatggtgtac cgcaagaagg cggaggcgag ccggcgcggg gacttcgtcg acgaggcctc cgcgcccacc
gagtccgaca tcgacgagac gttccagcgc ctcgtccgcg gccttggcaa gtccccccgc gaggtgttcg atgcgctccg
cagccagacc atcgacctcg tcctcaccgc cCACCCCACG CAGTCCGTCA GGCGTTCACT CCTCCAGAAG CACGCAAGGT
TAATTACAAG GGCACTACTG ATGCAGTGAT ATGCTTCCTT TCACTTGATC ATTGACGTGT TTTGCTGATG GATTTGTGAA
TTGTGATCAT TGTTTCAGCA TTAGGAGCTG CCTGACACAG CTCTGCGGCG AGGGCATCTC CGACAACGAG GAGCAGGAGA
TCGACGAGGC CCTTCAGAGA GAGGTGCTAC GACAACTCTC GAGCAATCAA TCTCGTCTCA AATTTGCGAC TGATCGTGTC
GTGTAATCAC TAATCAGATG GAGATGTGTT CGTCGGGTCG AATTCGCAGA TTCTCGCGGC GTTCAAGACG GACGAGATCC
GGCGGACGCC GCCGACGCCG CAGGACGAGA TGCGCGCCGG GATGAGCTAC TTCCACGACA CCATCTGGAA CGGCGTGCCC
AAGTTCCTCC GGCGCGTCGA CACAGCGCTC AAGAACATCG GCATCGACGA GCGCCTCCCC TACAACGCCC CCCTCATCCA
GTTCTCCTCA TGGATGGGCG GCGATCGCGA CGGTAGCTAA GCTATCCAAT CCATCCATTT TCAAAATTTG AGATGAGAGG
TGAGGAATTT AATCTGCAAG ATCGTCTTCC TCGTGAATTC GACGGTGCAG GGAATCCGAG GGTTACACCA GAGGTTACCA
GGGACGTGTG CCTGCTTGCC AGGATGATGG CTGCCAACAT GTACTTCTCC AAGATGGCCG ATTTGATGTT CGAGGTGCTT
GCTGCTCTGA ATTTTAGATT TGAATTTCTC AGTACAGACA TTGTTAATTC ggatttcatc cctggagggg atattccctc
gtttcgtgta tgccacctaa aaagttataa aaaaattgaa aaaatttggt ataaaatata tcacttcaca aacatgtaaa
accaaattca cttctacaag tGGCCTGTGG CTCTGAACTT CTAGTTTATC ACTGTTATGC TATTTGAAGC GCTGGCCTGT
GGCCTCTGAA TGCGCATTTG CTTCTGAGTT CTGACCTTCT GTCTCTGTAG CTCTCCATGT GGCGCTGCAA CGACGAGCTC
CGAGCTCGTG CCAACGAGTT GCACCGGAAG TCCTCAAGGA AGTACGCCAA ATACTACATT GGTATGATGC TTGATTGATT
TTATCTATCT AGCTTGaaaa ggagtaccac attcgctgtg gagactagaa attcccatat taatcggaga aaaaataaaa
aagaaaagga gagtccaagt agaaatacaa tctaaaaata gctgaaattc ggaattaaaa ataagcaata ttgaaagaag
tttccatata agaacccaat gcgagattaa tctaaattcg aaataaaaat aaaataaaat ccaaaattag aaaaaggaaa
ggagaatcta agtaggaata caatttaaaa atagctgaaa ttcgaaatta aaaaataagc aatattgaaa gaagtttcca
tataagaatc caatacggga ttaatcaaaa ttcgaaataa aaataaaata aaatccaaaa ttagaaaaga aaaggagagt
ccaagtagga atacaatata aaaataagca atattgaaag aagtttctgt ataagaaccc aatacgagat taatcaaaat
tctaaataaa aataaaataa aatccaaaat tagaaaaaga aaggagagtc caagtaggaa tacaatctaa aaataactga
aaattggaat taaaaataag caatattgaa aGAAGTTTCC ATATAagaac ccaatacgag attaatcaaa attcgaaata
aaaataaaat aaaatacaaa attagaaaag gaaaggagag ctcaagtagg aatacaattt tgaaacaact gaaattgaaa
ataaaaaatt aaaacattaa aagaaCATAA TACGGTAGTA ACTATTTTTT TAAAAAAATA AATTATGAAA TTAGAaaaag
aaaaataaga tttaaattag gaatacaatt tataaataac taaaatttgt gataaaaata aagactattg aaaaaaaaga
ccatctaaaa cacatgatga gataaattaa gtaacatgcc tataaaggag tagagtggtg gcggttgata tgacatataa
aaattgttaa taaaacacca gatagaatcc taatgacgat taaaaggagg aacgttgaac gttaggtagg ccgtaaagca
aacaagtaag gcacttgctg ggacttctag aaagtaaaaa aaaaaaccca ttgataatca tattcgattt ttaaaatctc
aatgacaata aaaatgagaa gcagcgggcg agatgtatag gagtatagtt gcagagccgc cgacggttga cgggacttct
ataaaattaa aaatgaattc caacgatagt tatgttcgat ttttagaatc acaataacaa taaaagagta ggcaacggac
gggctgtaga ggggcatagt gacatcgttt gatggggctt ctaaaaatta taaaaaataa aactgcaagt ccaattttta
aaggttccga acttccaaaa agtaaaaaaa cccaatgata atcatgttcg attttaaaat ctcaatgaca ataaagaaag
taggcagcgg gcgagccgta gaggagtaca atggcaaagc cgctgatggt ttggcgAGAC TTCTAGAAAG TAAAAATGAA
CCCAAACGAT AATTATGTTT GATTTTTAAA ATCTCAATGA CAATAAAGAG AAGAAACAGT GGACGGGCCG TAGAGGAGTA
TAAGGTAACG TTTGACGGGA CATCTAGAAA TTATAAAAAA AAACTCAACG TGACAATAAA CTCTAAAAAC TATAAAATCC
AATTTTTAAA GGTTCCAACA AGAATGAATA GAAATAGTGG TAGATCGAGC AAGCAAATAA AAAAGGAAAT GACATAAGGG
GTAGCAACTG GTGTGACTTT TAAAAACTAT ATAATTAGAA ACACGAGGAT GATAAGGTTT GGTCTTTTAA AGTCTTAAGA
CAATGAGATA GCTATTTAAT AAATTTTAAG TAAAATCATA CTAAAAAATA TATGATTTTG TTTGGGTGCT AGCCGCGCAA
TTGCGCGGGC CACCCAGCTA GTTtgttata aaaccggccc cgaaatcaca tcggaaacca aacgcggaag aaacgccata
ggagatccaa acatgatgac gacaccgagg cacgatattt gataacggag ttcagccgaa gcctacatct ccggggcact
gattacgggc gctcctcccc gatccagcat attacagcgt atcagagtta caatgactta cggccggtcg ctgccggcag
ccgctccctc tcactatgct aagtcgccat gcagttacaa caggcacgcc cctctattta tgagagatcc tatgatagag
tccgactcat actctagtcc tacacctatt acaactccaa gtcctaaact gtaaccgact acgtacacat atttgacaca
aactctaaca aactccacct tggcgaatat gccacgccaa cctgaatctg ttacttgctc gaacctccgt gtacccggac
ttgagttggt cctttttcgc cgctcatgcc gagctgcccc gacaagcctc caccaggctc accgtaaaca agagactccg
ctatccttgt aatttcttcc tcctaactcc acctgcaaca gtgctccacc ttctctcata tcaccatagt cgtcttgcca
aatgaaattg aattccttcc tagctgtcac atcatagact ctccgaagac catgttcacc tccatcttcc gtcttaaatt
tgacttgatc taatccatgg ccagataaca gatgtcatca ccaaaataga taaatcaaac tcaccagaca tgaagagaac
cctttcttcc ttgtcgtctt ataaaccaag ctaattaatc caacatccac gctttcccgc atccgtagac tgaattccgg
atagtttgag aaaatcaccg ttgctttgaa tcatctgaaa aaattaccac cacagcgctt gctcttcctc ttcagtgacg
cagattccat atatccccat catgcaaacc tcatagatcc tggatatacc ctgtactgct aaacagaccg ttgacaccca
caacgatttt cccccgctgt tgcccgggaa accatcttgc ccatccacga ctgccactgc cgagtccacg agttaacaca
ataccttgca attctacatg cacgatcctt ctcgcatata acttatctca ccagactact acacaagtat gtgctaacat
gtttgtcctt cgatacatgt accaggccaa caccatcacc atgtatggac acatgcatta gccatcaaac atcacgtgcg
catagtctag tcttcatcaa gttccaatgc actaatcacc ttgcatgctt gcttggtccc acgtgtaagc tgccttgact
caaccaccac agcccatagg caaaactagt ccaccgcgga acaggagatc ggtcaaacag aatcagatcg atcgatcccc
ttctgcttcc ttctgctcgt gctcctaccg cagcaagaga ccgccgctta cagcatcgct ctgcacgcct gctgcgaccg
tctccgtctc ggatctgcat aagcaccagg agcccgcacg cttcaccagc ttcctcaacg ccgccatcga agacgccgcc
ttggtttccg acatcgctgc ccgtcctgaa gcgcttcgtc gcctcctgag cccccccggt gagggcgccg ccgccgccgc
cgtgggcttc ccgccggtga ggatgccaac gcccacggaa gccttctccc cgacacagga gcgtcgccgc cgccccttcg
ccggtacctg ccgcctcctc gccagagccg gcccgcgtcg aactcgccgg cacctgcacg acgactacac caagccgtgc
ttctaccgct cgcagttcgt cgcccaaacc cctgccgccc aagaaatcgg gtccgatctc ttcattgctt tggttggttt
gattcgatcg caatctctgc aatcccgtgg attcctcttg ctaatttaca gggacaagtt gagcccgatt ctatttccaa
atcgaattct cctccggtcc cctttcgtgt ccgatgtggt atccttctcg atctcttctt gtcgtgtgta ttgaagccga
acctgtgctc gactcctttt ctactacggc ctctccgagt cgagtcctgc atgaaactgc tactaccagc actgcttcta
tctccaccgc cggctcggcc tcgacgcaaa accgcgcaca ccgccacgac cctgacctcc aagcttcaca tacccctagc
aacgtcctgg ttccagagca aacgcttctc tgttctgcca tccattgcat gtacgctgct aagtagcaat cctccatgca
gtacttgtcg ttaacacctc caaaacagcc tgttggatcc acccgctccg acttccgatt gaacgccatc aatctagtcg
cgagccgaag ccgacaagtc gcatgccgtc ttcccagcca tcgaacgacc cgagcgctac gtctagccat ctccctgtcg
agtgcagctc atcgaaaggc ctaggccacc ccgctcagag tgttcgatcc accgaccgag aacgccgatc gcctctagct
tcaatcaacc cgagcatggg gcctcacgtc tccctgttga gagtagctca ccggaaagtc cgggccaccc gcccgaagtg
tccgacccac cgattggatc gccaattgct tccgccgcca tcaacccgag caccacgtct agtcatctcc ttgttgaaag
cagccatcga acggttcaga ccgccgcctg aagtgttcga tccaccgatc aaattccgtt gattgccgcc gtgctccacc
ttgcgtccat gtccgtccct agacaccctg tgtagtcgtc gcagcatgga gcacctccct cgtacctcta ccatggatct
cccgcaggct ctgataccac ttgttataaa accggccccg aaatcacatc ggaaaccaaa cgcggaagaa acgccatagg
agatccaaac atgattacga caccgaggca cgatatttga taacggagtt cagccgaagc ctacatctcc ggggcactga
ttatgggcgc tcctcccgat ccagcatatt acagcgtatc agagttacaa cgacttacgg ccggtcactg ccggcagccg
ctccctctcg ctatgctaag tcgccatgca gttacaacag gcacacccct ctatttatga gagatcctag gatagagtcc
gactcatact ctagtcctac acctattaca actccaagtc ctatactgta accgactacg tacacatatt cgacacaaac
tctaacaGTA TTTTACTTAG ATGAGATGTT GAAATTATTT GCGATAATTG CTAGTTTTAT TCATCTATTG CAGAGTTTTG
GAAGAAGATT TCTCCAGGAG AACCTTACCG CATTATACTC GGCGATGTGA GGGACAAGCT GTACAACACC TGCGAGCGTG
CTCGCCAGAT CTTGTCGAAG GGAATTTCTA GCATTCCTGA AGACCAGACT TACACCAATG TCGAGCAGGT TGCAAAATTT
AAGCTCAAAA ACTATCACAG TGTTTGAAAC TCAGGATTTT CTCTGTAAAA TATACAGAAA GTAGTTTAGT TTCTTTATTG
ATCGGGGAAA AAATTCCCCG CATTCTAAAT GTGACTTCTC TAAACCATAT GAAGTTTATA CTTGGTGAAC TTTGCTGCAG
TTCTTGGAGC CGCTTGAGCT GTGCTACCGA TCGCTGTGCG ACTGCGGCGA CAAGCTGATC GCCGACGGCA GACTGCTCGA
CTTAATGCGG CAGGTCTCCA CCTTCGGCCT CTCCCTCGTC AAGCTCGACA TCCGGCAGGA GTCGGAGCGC CACACCGACG
CCATGGACGC GATCACCACG CACCTCGGCA TCGGCTCCTA CCGGGAGTGG CCCGAGGAGC GGCGCCAGGA GTGGCTCGTC
TCCGAGCTCC GCGGCAGGCG CCCGCTCTTC GGCCCCGACC TGCCGCAGTC CGAGGAGGTC GCCGACGTGC TCGGCGCGTT
CCGGGTCATC GCCGAGCTCC CCGCCGACAG CTTCGGCGCG TACATTATCT CCATGGCCAC CGCGCCGTCC GACGTGCTCG
CCGTCGAGCT GCTGCAGCGG GAGTGCGGCG TCAAGAAGCC CCTGAGGGTC GTCCCGCTGT TCGAGAAGCT CGCCGACCTT
CAGCAGGCGC GCGCCACCAT GGAGCTCCTC TTCTCCGTCG ACTGGTACAA GGAGCGGATC GACGGGAAGC AGGAGATCAT
GATCGGGTAC TCCGACTCCG GCAAGGACGC CGGCCGGCTG TCCGCGGCGT GGCAGCTGTA CAAGGCCCAG GAGGAGATCG
TCGGCGTGGC GGAGCGGCAC GGCGTGAAGC TGACCATCTT CCACGGCCGG GGCGGCACCG TGGGGCGCGG CGGCGGGCCG
AGCCACCTCG CCATCCTGTC CCAGCCGCCG AACACCGTCA ATGGCTCGCT CCGCGTGACT GTCCAGGGCG AGGTCATCGA
GAAGTCGTTC GGCGAGGAGA ACCTCTGCTT CCGGACGCTG CAGAGGTTCA CGGCGGCGAC CCTGGAGCAC GGCATGAACC
CGCCGGTGTC CCCGAAGCCC GAGTGGCGCC GCCTGCTCGA CGACATGGCG ACGGTGGCCA CTGACGAGTA CCGCTCCATC
GTGTTCCAGG AGCCGCGCTT CGTGGAGTAC TTCCGCGCCG CCACGCCGGA GACGGAGTAC GGGCGGATGA ACATCGGCAG
CCGGCCGTCG AAGCGGAAGC CCGGCGGCGG CATCGAGTCG CTGCGCGCCA TCCCGTGGAT CTTCGCGTGG ACGCAGACGC
GGTTCCACCT CCCCGTGTGG CTGGGCTTCG GCGCCGCGTT CAGGCACGCC ATGCAGCAGA GCGACGCCGG CGGCGGCCTC
GCCACGCTCC GCGAGATGTA CGACGAGTGG CCCTTCTTCC GCGTCACCAT CGACCTCCTC GAGATGGTCT TCGCCAAGGG
CGACCCCGGC ATCGCCGCAC TCTACGACGA GCTCCTCGTC CCCGACGACC TACGTCCATT CGGCGAGCAG CTCAGAGCCA
ACTACGTCGA GACACAGCGC CTGCTCCTGC AAGTAAGCAA TCATCACTTC ATCGGGAAAG TATTTTCTAG CACCCATGTT
TTATATATCA AAGTATTTTC ATCGGGAAAG TATTTTCCTG CAAGTAAGCA ATCATCACTG ATtttatcta gttatatatc
aaatttagtc ttacatgttt atcaattaaa tttatgtcgt catactaatt ttttctataa ctatttaagt catacatgaa
taatgccacg gcacATTTTA TCTCCATCGA ACACGCCGCC GTCATGATAT ATttttcgtg aaagcgtaaa aaattgcacg
ttaatatatt agaTCGCCGT GACATATCAC ACGCATTTGT TCGTATTCAT AGGTTGCTGG GCACAAGGAT CTCCTGGAGA
GTGATCCGTA CCTGAGGCAG CGGCTGATGC TGCGGGACTC GTACATCACG GCGCTGAACG TGTGCCAGGC GTACACGCTG
AAGCGGATCC GGGACGGCGG GTTCAGGCCG GAGACGCGGC CGCCGCTGTC GAAGGAGCTT CTGGGCTCGT CGGCGGTGGC
GGAGAAGCTG GTGAAGCTCA ACCCAAACAG CGAGTACGAC CCCGGGCTGG AGGACACGCT CATCCTCACC ATGAAGGGCA
TCGCCGCCGG CATGCAGAAC ACGGGCTGAT CGATGCAAAA GCACCATGGC CTTGCCGGTT AAAACTTTGT AGAGAAGATT
GGTGGGAGTG GATTGAGACT GTAAATTGGT GTTGCTGACT TGTTTCTGGT GCTTATTGGG TCAAGAACAG ATCGTACTGT
TCTTGTTTCT TCAGTTATCT CTGTTTTTTA GCAGTGATGG TACACGGATT TCCTGGTTCT AGCTTGAACC GTGATCACTG
TTTTCTTTCA GTAACGTAGC AGATTAACCT GGAGTGGGGA TATACCTGAG AATTCAGCTT CCCAAGCATA TCTTTTTTTG