Os01t0369700-01

Locus

Os01g0369700

Description

Similar to Glutathione S-transferase GST 8 (EC 2.5.1.18).

Transcript Evidence

AK101436 (DDBJ, Best hit)

AK063796 (DDBJ, Best hit)

Protein Evidence

Q8GTB9 (UniProt)

CGSNL Gene Symbol

GSTF5

CGSNL Gene Name

PHI GLUTATHIONE S-TRANSFERASE 5

CGSNL Gene Symbol Synonym(s)

OsGSTF5

CGSNL Gene Name Synonym(s)

Literature (PMID)

Manual Curation

Note

GO

Molecular Function: protein binding (GO:0005515)

InterPro

Glutathione S-transferase, N-terminal (IPR004045)

Glutathione S-transferase, C-terminal (IPR004046)

Glutathione S-transferase, C-terminal-like (IPR010987)

Thioredoxin-like fold (IPR012336)

Glutathione S-transferase/chloride channel, C-terminal (IPR017933)

KEGG

Os01t0369700-01 (EC:2.5.1.18)

KOME

J033039A11 (Online Clone Ordering)

001-121-F03 (Online Clone Ordering)

RiceXPro Database

AK101436

Oryzabase

9507

Plant Gene Family Database (PGFD)

Os01t0369700-01

Transcript

864 bp

>Os01t0369700-01 Similar to Glutathione S-transferase GST 8 (EC 2.5.1.18).
TTGTACAATAATAGACGCCCAGGGTAGCAACAAAATGGGCCGATGAGCAGCAACTATATA
TGTACCAACAAAGTGCAGGGCAAATTCAGCTGCAAGAAGGACCAATGGCGCCGATGAAAG
TGTACGGGTGGGTGGTATCGCCATGGATGGCGCGGGTGCTGGTGGCCCTGGAGGAGGCCG
GCGCCGAGTACGAGGTCGTTCCGATGAGCAGGTCCGGCGGCGACCACCGCCGGCCGGAGC
ACCTCGCCAGAAACCCGTTCGGTGAGATTCCAGTACTGGAGGATGGCGACCTGACGCTCT
ATCAATCGCGAGCAATCGCTAGGTACATCTTTCGCAAGTACAAACCAGAGTTCCTGGGAC
TCGGAGAAGGTGGAAGCCTGGAGGAGTCGGCAATGGTGGACGTGTGGCTGGACGTGGAAG
CCCACCAGCACGAGGCCGCCGTGAGGCCCATCCTGTGGCACTGCATCATCAACAAGTTCG
AGGGCCGCGACCGCGACCAGGGCGTCGTGGACGAGAGCGTCCGGAAGCTGGAGAAGGTGC
TCGGGGTGTACGAGGCGAGGCTGTCGGGCTCCAGGTACCTCGCCGGCGACCGCATCAGCC
TCGCGGACCTCAGCCACTTCTCCAACATGCGCTACTTCATGGCGACGGAGTACGCCGGCG
TGGTCGACGCGTACCCGCACGTGAAGGCGTGGTGGGAGGCGCTGCTGGCCAGGCCGACGG
TGCAGAAGGTGATGGCCGGCATGCCACCGGATTTCGGCTTCGGAAGTGGGAACATACCAT
AGTGTGCTTGCTGTTGTCCAGCTTTGCAGCTTGTTATTAGCATGTCTGCATTTCCAATAA
ATGGGATAGCCAGCTCTGAGAACC

CDS

723 bp

>Os01t0369700-01 Similar to Glutathione S-transferase GST 8 (EC 2.5.1.18).
ATGTACCAACAAAGTGCAGGGCAAATTCAGCTGCAAGAAGGACCAATGGCGCCGATGAAA
GTGTACGGGTGGGTGGTATCGCCATGGATGGCGCGGGTGCTGGTGGCCCTGGAGGAGGCC
GGCGCCGAGTACGAGGTCGTTCCGATGAGCAGGTCCGGCGGCGACCACCGCCGGCCGGAG
CACCTCGCCAGAAACCCGTTCGGTGAGATTCCAGTACTGGAGGATGGCGACCTGACGCTC
TATCAATCGCGAGCAATCGCTAGGTACATCTTTCGCAAGTACAAACCAGAGTTCCTGGGA
CTCGGAGAAGGTGGAAGCCTGGAGGAGTCGGCAATGGTGGACGTGTGGCTGGACGTGGAA
GCCCACCAGCACGAGGCCGCCGTGAGGCCCATCCTGTGGCACTGCATCATCAACAAGTTC
GAGGGCCGCGACCGCGACCAGGGCGTCGTGGACGAGAGCGTCCGGAAGCTGGAGAAGGTG
CTCGGGGTGTACGAGGCGAGGCTGTCGGGCTCCAGGTACCTCGCCGGCGACCGCATCAGC
CTCGCGGACCTCAGCCACTTCTCCAACATGCGCTACTTCATGGCGACGGAGTACGCCGGC
GTGGTCGACGCGTACCCGCACGTGAAGGCGTGGTGGGAGGCGCTGCTGGCCAGGCCGACG
GTGCAGAAGGTGATGGCCGGCATGCCACCGGATTTCGGCTTCGGAAGTGGGAACATACCA
TAG

Protein

241 aa

>Os01t0369700-01 Similar to Glutathione S-transferase GST 8 (EC 2.5.1.18).
MYQQSAGQIQLQEGPMAPMKVYGWVVSPWMARVLVALEEAGAEYEVVPMSRSGGDHRRPE
HLARNPFGEIPVLEDGDLTLYQSRAIARYIFRKYKPEFLGLGEGGSLEESAMVDVWLDVE
AHQHEAAVRPILWHCIINKFEGRDRDQGVVDESVRKLEKVLGVYEARLSGSRYLAGDRIS
LADLSHFSNMRYFMATEYAGVVDAYPHVKAWWEALLARPTVQKVMAGMPPDFGFGSGNIP
*

5'UTR

chr01:15171801..15171859 (- strand) : 59 bp

CDS

chr01:15171606..15171800 (- strand) : 195 bp

chr01:15171264..15171312 (- strand) : 49 bp

chr01:15170568..15171046 (- strand) : 479 bp

3'UTR

chr01:15170486..15170567 (- strand) : 82 bp

FASTA

>Os01t0369700-01 class=Sequence position=chr01:15170486..15171859 (- strand)
TTGTACAATA ATAGACGCCC AGGGTAGCAA CAAAATGGGC CGATGAGCAG CAACTATATA TGTACCAACA AAGTGCAGGG
CAAATTCAGC TGCAAGAAGG ACCAATGGCG CCGATGAAAG TGTACGGGTG GGTGGTATCG CCATGGATGG CGCGGGTGCT
GGTGGCCCTG GAGGAGGCCG GCGCCGAGTA CGAGGTCGTT CCGATGAGCA GGTCCGGCGG CGACCACCGC CGGCCGGAGC
ACCTCGCCAG AAACGTACGT GAGCCTCTCA TAATTCTCGC ACTATATCTT CTTCGCATGT TACGCAAATT AGTCCAAAGG
GTCAGAGCGA CCTACAGTGC AGGCTGATTC ATGGAATACC TGCACTTCGA TTGCCCAATA GTAGACTATA TGTTGGCAAT
AGACGTTAGG ATCCGAATTG TCATGAATAC TCGGTTATTT GGATGCGCTT TTTGCCCACG AGTTGTTGTT TCCAAACTTA
ATTTCTCCTG CTAAGAACAT TTCAATTCCT GCTTATTAAA GTTGTTTTCT GTATATCAAT TATGCAGCCG TTCGGTGAGA
TTCCAGTACT GGAGGATGGC GACCTGACGC TCTATCGTAA GCAAGCTTGA CTTGTATTCT TGTTTTCGTC GATTGAATTC
TATTTGCTTC TCTGAATTAT TCCAATCAAA ACTAATACTT GTTGTTCTCT GAATAACTGT TCAATTAATA GTAGAGATTC
AGTAATTCTT TATTCAAGAT CACGGATACA CATACTATAT AACACACTAT GCCCAAAAGA AGAAACTAAA ATCGTTTGTA
TTTTTCTTGT CAGAATCGCG AGCAATCGCT AGGTACATCT TTCGCAAGTA CAAACCAGAG TTCCTGGGAC TCGGAGAAGG
TGGAAGCCTG GAGGAGTCGG CAATGGTGGA CGTGTGGCTG GACGTGGAAG CCCACCAGCA CGAGGCCGCC GTGAGGCCCA
TCCTGTGGCA CTGCATCATC AACAAGTTCG AGGGCCGCGA CCGCGACCAG GGCGTCGTGG ACGAGAGCGT CCGGAAGCTG
GAGAAGGTGC TCGGGGTGTA CGAGGCGAGG CTGTCGGGCT CCAGGTACCT CGCCGGCGAC CGCATCAGCC TCGCGGACCT
CAGCCACTTC TCCAACATGC GCTACTTCAT GGCGACGGAG TACGCCGGCG TGGTCGACGC GTACCCGCAC GTGAAGGCGT
GGTGGGAGGC GCTGCTGGCC AGGCCGACGG TGCAGAAGGT GATGGCCGGC ATGCCACCGG ATTTCGGCTT CGGAAGTGGG
AACATACCAT AGTGTGCTTG CTGTTGTCCA GCTTTGCAGC TTGTTATTAG CATGTCTGCA TTTCCAATAA ATGGGATAGC
CAGCTCTGAG AACC