Os01t0742500-01

Locus

Os01g0742500

Description

Similar to Hexokinase.

Transcript Evidence

AK065656 (DDBJ, Best hit)

Protein Evidence

Q8LQ68 (UniProt)

CGSNL Gene Symbol

HXK6

CGSNL Gene Name

HEXOKINASE-6

CGSNL Gene Symbol Synonym(s)

OsHXK6

CGSNL Gene Name Synonym(s)

Hexokinase 6

Literature (PMID)

Manual Curation

Note

GO

Biological Process: carbohydrate metabolic process (GO:0005975)

Biological Process: glycolysis (GO:0006096)

Molecular Function: hexokinase activity (GO:0004396)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: phosphotransferase activity, alcohol group as acceptor (GO:0016773)

InterPro

Hexokinase (IPR001312)

Helix-loop-helix DNA-binding (IPR011598)

Hexokinase, conserved site (IPR019807)

Hexokinase, N-terminal (IPR022672)

Hexokinase, C-terminal (IPR022673)

KEGG

Os01t0742500-01 (EC:2.7.1.1)

KOME

J013039E17 (Online Clone Ordering)

RiceXPro Database

AK065656

Oryzabase

9007

Plant Gene Family Database (PGFD)

Os01t0742500-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os01t0742500-01

Transcript

2155 bp

>Os01t0742500-01 Similar to Hexokinase.
AGAGGAGAGAGACTGAGGGAGGGAGGCAGGAGGAAGGAGGAGGAGGAGGACGCTGCAGTG
GTGGGTGGCGTAGCTCCCGATCCGGGAAGCCGACCCGGTCTGGGGGATTTGCTCCTGGCG
CGCGCTCGATCGAGAGGGAGGCCAGGGTTGGGTTGGGGGGAGCGTGAAGAAGCGCGCGCG
CGGCTATGGGGAAGGGGACGGTAGTGGGGACGGCGGTGGTGGTGTGCGCTGCAGCGGCCG
CGGCGGTTGGGGTGGCGGTGGTGGTGTCGCGGAGGAGGAGGAGCAAGCGGGAGGCGGAGG
AGGAGCGGCGGAGGAGGGCCGCCGCTGTGATCGAGGAGGTGGAGCAGAGGTTCTCGACGC
CCACGGCGCTGCTGCGCGGCATCGCGGACGCCATGGTGGAGGAGATGGAGCGCGGCCTCC
GCGCCGACCCTCACGCCCCGCTCAAGATGCTCATCAGCTACGTCGACAACCTCCCCACCG
GGGATGAGCACGGACTGTTCTATGCTCTCGATCTTGGGGGCACCAATTTCCGTGTTATAC
GTGTTCAGCTTGGAGGAAGGGAAAAGCGTGTTGTTAGTCAACAGTACGAAGAGGTTGCCA
TTCCACCTCACCTGATGGTTGGGACTTCTATGGAACTGTTTGACTTCATTGCGGCTGAGT
TGGAAAGTTTTGTCAAGACCGAGGGAGAGGATTTCCACTTGCCAGAGGGCAGGCAGAGAG
AGTTAGGCTTCACCTTTTCTTTCCCAGTGCACCAAACATCAATATCATCAGGCACTCTTA
TTAAGTGGACAAAGGGATTTTCCATCAATGGCACGGTGGGGGAAGATGTTGTGGCTGAAT
TGAGCAGGGCTATGGAAAGGCAAGGGCTTGATATGAAAGTTACAGCTCTTGTTAATGACA
CTGTAGGCACATTGGCTGGCGGAAGATATGTTGATAATGACGTTGCTGCTGCTGTAATAT
TAGGCACTGGCACAAACGCAGCCTACGTGGAGCATGCAAATGCAATTCCAAAATGGACTG
GATTACTACCTAGATCAGGAAATATGGTGATTAACATGGAATGGGGAAACTTCAAGTCAG
AAAGGCTTCCTCGTTCAGATTACGATAATGCCTTGGACTTTGAAAGTTTAAACCCAGGCG
AGCAGATATATGAAAAGATGATTTCCGGCATGTATCTTGGAGAGATTGTGCGCAGAATCT
TGCTTAAGCTTGCTCATGATGCTTCCTTGTTTGGAGATGTTGTTCCAACAAAGCTGGAGC
AGCGCTTTATACTGAGGACGCCGGACATGTCAGCGATGCATCATGATACCTCACATGATC
TGAAACACCTGGGAGCTAAGCTGAAGGATATCCTGGGGGTCGCTGATACTTCCCTGGAAG
CACGATACATCACCCTTCATGTCTGCGACCTCGTTGCAGAGAGAGGTGCACGCTTAGCTG
CTGCTGGTATATATGGCATTCTAAAGAAGCTGGGCAGGGACAGAGTGCCAAGTGACGGTA
GTCAAAAGCAGAGGACTGTCATTGCTCTGGATGGTGGTCTCTATGAGCATTACAAGAAGT
TCAGAACCTGCCTAGAAGCAACGCTTGCAGACCTGCTTGGAGAGGAGGCTGCCTCATCAG
TTGTTGTCAAGTTGGCAAACGATGGCTCTGGCATCGGAGCTGCACTTCTTGCAGCATCTC
ACTCCCAGTATGCTAGCGTCGAGTAGTAACAGGAGCTCATGGGACTGAGCTCCCAGTGTA
GCTTGTTTTCCTCCCATTTTCCCCGTTTCTTTCCAATGGGAGTTCGTTTCCCTCCTGCGA
TTCGCATCTCCTTTTGCTATTCTGCAGTCACATAAACGAGTGCCTGTGCAGCGGGATGTA
GCTAGTATGGCGCCAAAGAGTTTGCAGTTATCACATGAACAAGCATTTGCAACTGCAGGG
AAGTGAAAACGGGGGCTTGAATGATGCCGTTCTTTTCCTGCAAATTATTTTCCCCCTTTC
CCTGTAAGTTTGTATTGTGATGCGATGTCGCAAACCAATCACAGCGGTTTCGCGTGTAGC
CTTTTGTCATTCAGATTTCAGAATAAAGAGGGGGACATAATTTCACTTTTCGTATGTCAG
TTTGAACTATGTATGTACTCTTACACACTGGTATCAAAGCTCAAATGATCTGATC

CDS

1521 bp

>Os01t0742500-01 Similar to Hexokinase.
ATGGGGAAGGGGACGGTAGTGGGGACGGCGGTGGTGGTGTGCGCTGCAGCGGCCGCGGCG
GTTGGGGTGGCGGTGGTGGTGTCGCGGAGGAGGAGGAGCAAGCGGGAGGCGGAGGAGGAG
CGGCGGAGGAGGGCCGCCGCTGTGATCGAGGAGGTGGAGCAGAGGTTCTCGACGCCCACG
GCGCTGCTGCGCGGCATCGCGGACGCCATGGTGGAGGAGATGGAGCGCGGCCTCCGCGCC
GACCCTCACGCCCCGCTCAAGATGCTCATCAGCTACGTCGACAACCTCCCCACCGGGGAT
GAGCACGGACTGTTCTATGCTCTCGATCTTGGGGGCACCAATTTCCGTGTTATACGTGTT
CAGCTTGGAGGAAGGGAAAAGCGTGTTGTTAGTCAACAGTACGAAGAGGTTGCCATTCCA
CCTCACCTGATGGTTGGGACTTCTATGGAACTGTTTGACTTCATTGCGGCTGAGTTGGAA
AGTTTTGTCAAGACCGAGGGAGAGGATTTCCACTTGCCAGAGGGCAGGCAGAGAGAGTTA
GGCTTCACCTTTTCTTTCCCAGTGCACCAAACATCAATATCATCAGGCACTCTTATTAAG
TGGACAAAGGGATTTTCCATCAATGGCACGGTGGGGGAAGATGTTGTGGCTGAATTGAGC
AGGGCTATGGAAAGGCAAGGGCTTGATATGAAAGTTACAGCTCTTGTTAATGACACTGTA
GGCACATTGGCTGGCGGAAGATATGTTGATAATGACGTTGCTGCTGCTGTAATATTAGGC
ACTGGCACAAACGCAGCCTACGTGGAGCATGCAAATGCAATTCCAAAATGGACTGGATTA
CTACCTAGATCAGGAAATATGGTGATTAACATGGAATGGGGAAACTTCAAGTCAGAAAGG
CTTCCTCGTTCAGATTACGATAATGCCTTGGACTTTGAAAGTTTAAACCCAGGCGAGCAG
ATATATGAAAAGATGATTTCCGGCATGTATCTTGGAGAGATTGTGCGCAGAATCTTGCTT
AAGCTTGCTCATGATGCTTCCTTGTTTGGAGATGTTGTTCCAACAAAGCTGGAGCAGCGC
TTTATACTGAGGACGCCGGACATGTCAGCGATGCATCATGATACCTCACATGATCTGAAA
CACCTGGGAGCTAAGCTGAAGGATATCCTGGGGGTCGCTGATACTTCCCTGGAAGCACGA
TACATCACCCTTCATGTCTGCGACCTCGTTGCAGAGAGAGGTGCACGCTTAGCTGCTGCT
GGTATATATGGCATTCTAAAGAAGCTGGGCAGGGACAGAGTGCCAAGTGACGGTAGTCAA
AAGCAGAGGACTGTCATTGCTCTGGATGGTGGTCTCTATGAGCATTACAAGAAGTTCAGA
ACCTGCCTAGAAGCAACGCTTGCAGACCTGCTTGGAGAGGAGGCTGCCTCATCAGTTGTT
GTCAAGTTGGCAAACGATGGCTCTGGCATCGGAGCTGCACTTCTTGCAGCATCTCACTCC
CAGTATGCTAGCGTCGAGTAG

Protein

507 aa

>Os01t0742500-01 Similar to Hexokinase.
MGKGTVVGTAVVVCAAAAAAVGVAVVVSRRRRSKREAEEERRRRAAAVIEEVEQRFSTPT
ALLRGIADAMVEEMERGLRADPHAPLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVIRV
QLGGREKRVVSQQYEEVAIPPHLMVGTSMELFDFIAAELESFVKTEGEDFHLPEGRQREL
GFTFSFPVHQTSISSGTLIKWTKGFSINGTVGEDVVAELSRAMERQGLDMKVTALVNDTV
GTLAGGRYVDNDVAAAVILGTGTNAAYVEHANAIPKWTGLLPRSGNMVINMEWGNFKSER
LPRSDYDNALDFESLNPGEQIYEKMISGMYLGEIVRRILLKLAHDASLFGDVVPTKLEQR
FILRTPDMSAMHHDTSHDLKHLGAKLKDILGVADTSLEARYITLHVCDLVAERGARLAAA
GIYGILKKLGRDRVPSDGSQKQRTVIALDGGLYEHYKKFRTCLEATLADLLGEEAASSVV
VKLANDGSGIGAALLAASHSQYASVE*

5'UTR

chr01:31013770..31013954 (- strand) : 185 bp

CDS

chr01:31013474..31013769 (- strand) : 296 bp

chr01:31012575..31012725 (- strand) : 151 bp

chr01:31012296..31012478 (- strand) : 183 bp

chr01:31011619..31011693 (- strand) : 75 bp

chr01:31011253..31011408 (- strand) : 156 bp

chr01:31011014..31011112 (- strand) : 99 bp

chr01:31010810..31010940 (- strand) : 131 bp

chr01:31010515..31010596 (- strand) : 82 bp

chr01:31010075..31010422 (- strand) : 348 bp

3'UTR

chr01:31009626..31010074 (- strand) : 449 bp

FASTA

>Os01t0742500-01 class=Sequence position=chr01:31009626..31013954 (- strand)
AGAGGAGAGA GACTGAGGGA GGGAGGCAGG AGGAAGGAGG AGGAGGAGGA CGCTGCAGTG GTGGGTGGCG TAGCTCCCGA
TCCGGGAAGC CGACCCGGTC TGGGGGATTT GCTCCTGGCG CGCGCTCGAT CGAGAGGGAG GCCAGGGTTG GGTTGGGGGG
AGCGTGAAGA AGCGCGCGCG CGGCTATGGG GAAGGGGACG GTAGTGGGGA CGGCGGTGGT GGTGTGCGCT GCAGCGGCCG
CGGCGGTTGG GGTGGCGGTG GTGGTGTCGC GGAGGAGGAG GAGCAAGCGG GAGGCGGAGG AGGAGCGGCG GAGGAGGGCC
GCCGCTGTGA TCGAGGAGGT GGAGCAGAGG TTCTCGACGC CCACGGCGCT GCTGCGCGGC ATCGCGGACG CCATGGTGGA
GGAGATGGAG CGCGGCCTCC GCGCCGACCC TCACGCCCCG CTCAAGATGC TCATCAGCTA CGTCGACAAC CTCCCCACCG
GGTAGGCCTC CCTCCGCTCC GCTTGTGCGA TTTTTATGAT TTCTGGGGTG TACGTGACAC GAGAAAGCTT GGGAATAGTT
GTTACTGTGT TCGCGAGGGG TGTTTCTCTT CGGGGGCGAA TCGGTTGGAA ATCCCTAGCG GCTTAGCGCT TGCTTAGGTT
CGGATTTGGC ATAAATGTGG CATTGATCTT CGGTTGTTGA GATGGAGGTG CGACATATTG ATATCAAGAG CACTGTGCCT
TGACACGGCC TTTTAGCTCT TTTCTTATTG ATCACGGAAG AATGATGAGA CCTATTCGTT TCCTATGGAA TTTTGATCTA
CTGAGTGGAG GTTTCTCACG GTGGTAGCAG AAAGTGGCCA CCAGGATAGA CTTGACATAA TTTTTTTTTC GCAGTGAAGA
CTCCAGACAG AATTATAAAA TGAACAATTA GGTTCCGGTC ACTTTTGACA ACTATATATA TCTGTGTGTC CATTTTGTAA
TTTGTGCCTT CATGCTGGGC TTACGATCAG TCGATCACAG AACAATCGTT CTTTTTTTTG TACCATGTGA ATTTTGTAGG
AAATGTCATG AAAGGTTTAT GAATAAGTTT AGAGAAAGAA ATGGTCAAGG ACTCGAGGCT TAAAAGTTTC AGTGAGTTTG
ACAGTTTATT ATATGTATCC ATAGGCGTAT GGAAAATGAA AAATGTTGAG CCTATCACTT CATGAAATCT TCTTTTATGC
TTCCTCTGAT TTGCATGCCA CTTGTGCAGG GATGAGCACG GACTGTTCTA TGCTCTCGAT CTTGGGGGCA CCAATTTCCG
TGTTATACGT GTTCAGCTTG GAGGAAGGGA AAAGCGTGTT GTTAGTCAAC AGTACGAAGA GGTTGCCATT CCACCTCACC
TGATGGTTGG GACTTCTATG GTCAGTGGCT TATTCCTTTC AACTGTTATG TTTCAATTCT CCTGTGTTTG CACAATTTCT
TTCATGGTTA CTCAAATTTC AGAAATATGA GTACAGGAAC TGTTTGACTT CATTGCGGCT GAGTTGGAAA GTTTTGTCAA
GACCGAGGGA GAGGATTTCC ACTTGCCAGA GGGCAGGCAG AGAGAGTTAG GCTTCACCTT TTCTTTCCCA GTGCACCAAA
CATCAATATC ATCAGGCACT CTTATTAAGT GGACAAAGGG ATTTTCCATC AATGGCACGG TAAAATTCGA ATGGCCTTAG
TATAAATTTC ATGGCTAAAT GATCTAGGAA TTATTTATTA CCTTGACGAT CAGTCTTGAT TAGAAACCAC GTTGTGTCAG
CAAACGAATT CTCACTAGCT GTGTCACTTT TGACTTTTGG GTTCCCTGCA TTGACCAAGT GACCAGCCGT TGCCCTTCAT
TTTCCTTTCA GAATATTTGG ACTGATGTTT GGTTATCCAT AAATTAACAT GTTTGGTAAA GTTATTCTTA GATGTGATAT
AAACGGGACA TGGTGGCATA TGTCCCCATT TATCCAATTC ACAAGTATCT TATAATTGCT TCTAAATCCT GCGGCGATTG
TGAATGCAGA TGTTACAATT AGAGCTGTGT TTGCTATACA ACACTTGTAA CCATAAAAAA ATGTATTTGC TTATCCTGCA
CTTCTTAAAT TTGAACCTCC AAGAATGAAG CACTCTAGTC ATATTTCTGT TTCCTACTTT TAATGTGGCA ATTTCTAGCC
TCTCAAGACA AATGTGGCAT CAACACTGCA ATATCTTTTT TAATTTTATA ATGTTATGCC CATAATTTTG ATGTATAGAC
TAATGATTTC TGTGAACTCA GGTGGGGGAA GATGTTGTGG CTGAATTGAG CAGGGCTATG GAAAGGCAAG GGCTTGATAT
GAAAGTTACA GCTCTTGTAA GTAAATTCTT GGTTCATGAC TCTGTTAAAA TTATTTATCA TCTGAAACTT TCCCATGCCT
GCTACTGCTA TATGCTGATG GGTAAATACA TTGGCATTCC TATGAAAATG CTGACTTTGG AGTTTTTCAA TGTTCTATGA
GTTTGGATGT TTACTAGTAT ATCACCAGAC TGTGTCATGT AAATTGACAA CTAATATTTT GCCCAGGTTA ATGACACTGT
AGGCACATTG GCTGGCGGAA GATATGTTGA TAATGACGTT GCTGCTGCTG TAATATTAGG CACTGGCACA AACGCAGCCT
ACGTGGAGCA TGCAAATGCA ATTCCAAAAT GGACTGGATT ACTACCTAGA TCAGGAAATA TGGTTAGTGA CTGATTTCGT
TATACTTGTA GCATTAAATG TCTTTGAACC TTGTATAAAT GTATGTATCC ACTTCAACTT CTGCACTGGA TGATTGTCAC
ATCAATTAAT ATTATAACAT TTGGATCTTT GGTATGATGA AGGTGATTAA CATGGAATGG GGAAACTTCA AGTCAGAAAG
GCTTCCTCGT TCAGATTACG ATAATGCCTT GGACTTTGAA AGTTTAAACC CAGGCGAGCA GGTATTGTTT ATTTTATCTT
TTTATTTTCC AACTATATGT GGGCATGAAA GAATTTCGGT CTTCTTTTCC TCAGATATAT GAAAAGATGA TTTCCGGCAT
GTATCTTGGA GAGATTGTGC GCAGAATCTT GCTTAAGCTT GCTCATGATG CTTCCTTGTT TGGAGATGTT GTTCCAACAA
AGCTGGAGCA GCGCTTTATA CTGAGGTGCA CTTCTATGTC CCCTATGTTG ATCATCTAAG TATCTAGCTT TTCATATATG
CAGCACAGAA CTATCAAAAT AAGATAAAAT TTCAACATAG ACTGTATGGT GTGCATTATG CGTTCCTTGA TCATGGTAGC
ACAGAACTAT CAAAATAAGA TAAATTCATG TAACTATGTA GAAAATTTCT TAACGGAACT CCAATTGTGG TATTGCAGGA
CGCCGGACAT GTCAGCGATG CATCATGATA CCTCACATGA TCTGAAACAC CTGGGAGCTA AGCTGAAGGA TATCCTGGGG
GTATGATAAT ACATATCTTG AAAATAGGAT ACTATCAAAT CTAATTTTCA AGAACCATTG ATTACTTACG ATATGCCTGA
ACTTATGTTT AGGTCGCTGA TACTTCCCTG GAAGCACGAT ACATCACCCT TCATGTCTGC GACCTCGTTG CAGAGAGAGG
TGCACGCTTA GCTGCTGCTG GTATATATGG CATTCTAAAG AAGCTGGGCA GGGACAGAGT GCCAAGTGAC GGTAGTCAAA
AGCAGAGGAC TGTCATTGCT CTGGATGGTG GTCTCTATGA GCATTACAAG AAGTTCAGAA CCTGCCTAGA AGCAACGCTT
GCAGACCTGC TTGGAGAGGA GGCTGCCTCA TCAGTTGTTG TCAAGTTGGC AAACGATGGC TCTGGCATCG GAGCTGCACT
TCTTGCAGCA TCTCACTCCC AGTATGCTAG CGTCGAGTAG TAACAGGAGC TCATGGGACT GAGCTCCCAG TGTAGCTTGT
TTTCCTCCCA TTTTCCCCGT TTCTTTCCAA TGGGAGTTCG TTTCCCTCCT GCGATTCGCA TCTCCTTTTG CTATTCTGCA
GTCACATAAA CGAGTGCCTG TGCAGCGGGA TGTAGCTAGT ATGGCGCCAA AGAGTTTGCA GTTATCACAT GAACAAGCAT
TTGCAACTGC AGGGAAGTGA AAACGGGGGC TTGAATGATG CCGTTCTTTT CCTGCAAATT ATTTTCCCCC TTTCCCTGTA
AGTTTGTATT GTGATGCGAT GTCGCAAACC AATCACAGCG GTTTCGCGTG TAGCCTTTTG TCATTCAGAT TTCAGAATAA
AGAGGGGGAC ATAATTTCAC TTTTCGTATG TCAGTTTGAA CTATGTATGT ACTCTTACAC ACTGGTATCA AAGCTCAAAT
GATCTGATC