Os01t0758300-01

Locus

Os01g0758300

Description

Similar to Phosphoenolpyruvate carboxylase, housekeeping isozyme (EC 4.1.1.31) (PEPCase).

Transcript Evidence

AK101274 (DDBJ, Best hit)

Protein Evidence

P29193 (UniProt)

CGSNL Gene Symbol

CGSNL Gene Name

CGSNL Gene Symbol Synonym(s)

CGSNL Gene Name Synonym(s)

Literature (PMID)

Manual Curation

Note

GO

Biological Process: tricarboxylic acid cycle (GO:0006099)

Biological Process: carbon fixation (GO:0015977)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: phosphoenolpyruvate carboxylase activity (GO:0008964)

InterPro

Pyruvate/Phosphoenolpyruvate kinase (IPR015813)

Phosphoenolpyruvate carboxylase, active site (IPR018129)

Phosphoenolpyruvate carboxylase (IPR021135)

KEGG

Os01t0758300-01 (EC:4.1.1.31)

KOME

J033033B07 (Online Clone Ordering)

RiceXPro Database

AK101274

Plant Gene Family Database (PGFD)

Os01t0758300-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os01t0758300-01

Transcript

3055 bp

>Os01t0758300-01 Similar to Phosphoenolpyruvate carboxylase, housekeeping isozyme (EC 4.1.1.31) (PEPCase).
GCATTGGCCGTTCGGATCGCGGTGGCGCTTCGTGAAGGTGGGGGAGAAGGGGGAAAAGGA
GTCGGCTTTCGGGGAGATGGCGCGCAATGCGGCGGACAAGGGGACGTCCATCGACGCGCA
GCTGCGGATCCTGGCGCCTAAGAAGCTCTCGGAGGACGACAAGCTTGTGGAGTACGACGC
GCTGCTCCTCGATCGCTTCCTCGACATCCTCCAGGATCTGCATGGGGAGGACATCAGGGA
GACGGTTCAAGAATGCTATGAATTAGCTGCTGAGTATGAAAGTAAGATTGCGTATCGTAG
GAGGATAAAACTGAAGAAGGGTGATTTTGCTGATGAAAACTCTGCTACAACTGAATCAAA
CTTTGAGGAGACCCTAAAAAGGCTTGTTGGTGAGCTTAAGAAGTCCCCTCATGAGGTATT
TGATGCTCTCAAGAATCAAACAATCGACCTGGTCCTGACAGCACATCCAACTCAGTCAGT
CAGGAGGTCGCTGCTACAAAAGCATGGCAGGATAAGAAGTTGTTTAACAAAACTTTATGC
AAAAGACATAACTCCAGATGAGAAGCAGGAACTCGATGAAGCACTTAAGAGAGAGATCCA
AGCCGCCTTTAGAACAGATGAAATTCGGCGAGCACCTCCTACACCACAGGATGAAATGCG
TGCTGGAATGAGTTATTTTCATGAGACAATATGGAAGGGTGTACCCAAGTTTTTACGTAG
GGTTGATACTGCCCTTAAGAACATTGGCATAAACGAGCGAGTGCCCTATAATGCTCCTCT
TATTCAATTTTCTTCTTGGATGGGTGGAGACCGTGATGGAAATCCAAGAGTCACACCAGA
GGTTACAAGGGACGTATGCCTGTTAGCTAGAATGATGGCTGCTAACTTATACTATGCACA
GATAGAGGATCTGATGTTTGAGCTATCTATGTGGCGCTGTAGTGATGAACTACGTGTAAA
AGCTGATCAGTTACACCGTTGCGCAAAGAAAAACACAACAAAGCACTATATAGAGTTCTG
GAAACAAGTTCCTCCGAGTGAACCCTATCGTGTAATACTGAGCAATGTCAGAGATAAGTT
GTACAATACACGCGAGCGAGCACGCCATTTATTAGCCAGTGGATTTTCTGAAATTCCTGA
CGAAGCAACATTCACTGATGTTGAGCAGTTCTTGGAGCCTCTTGAGCTCTGTTACAGGTC
TCTCTGTGCCTGTGGTGATAATTCTATTGCAGATGGCAGTCTTCTTGACTTTCTACGGCA
AGTGTCCACATTTGGACTATCCCTTGTTAGACTTGATATTAGGCAAGAATCTGACCGACA
TACTGATGTTATGGATGCCATAACTCAATACCTTGGAATTGGATCCTATCGTGAATGGTC
AGAGGAGAAACGCCAAGAATGGCTTCTGTCAGAACTCAATGGAAAGAGGCCATTATTTGG
TCCTGACCTTCCCCAGACGGATGAAATTGCTGATGCCCTAGATACTTTTCATGTGATAGC
AGAACTACCCTATGATAGCTTTGGTGCATATGTAATATCCATGGCAACAGCTCCTTCAGA
TGTTCTAGCAGTTGAGCTTCTGCAACGTGAATGTCATGTGAAGAAGCCACTGAGAGTTGT
GCCATTGTTTGAAAAACTAGCAGATCTGGAAGCAGCACCAGCAGCTCTTGCCCGACTTTT
CTCTGTTGACTGGTACAGAAATAGGATCGACGGAAAGCAGGAAGTAATGATTGGGTATTC
AGATTCTGGAAAAGATGCTGGCCGTTTCTCTGCAGCTTGGGAACTGTATAAAGCTCAAGA
GGAGCTTATTAAAGTTGCTAAGCAGTTTGGGGTTAAGTTGACTATGTTTCATGGGCGAGG
TGGAACTGTTGGAAGAGGTGGGGGTCCTACACACCTTGCTATACTGTCACAACCTCCAGA
TACCATTCATGGATCACTTCGTGTGACTGTTCAAGGTGAAGTCATTGAGCAATCTTTTGG
AGAGGAGCATTTGTGTTTTAGGACACTTCAACGTTTTACATCTGCTACTCTTGAGCATGG
TATGCATCCACCAATTTCACCAAAGCCAGAATGGCGTGCTTTGATGGATGAAATGGCCGC
TGTTGCTACAAAAGAATACCGGTCCATTGTCTTCCAAGAGGCACGATTTGTTGAATATTT
CCGCCTTGCAACACCAGAGTTGGAATATGGTAGGATGAATATTGGAAGTAGGCCATCAAA
ACGAAAGCCTAGTGGAGGCATTGAATCACTTCGTGCAATTCCTTGGATCTTTGCTTGGAC
ACAAACTCGATTCCACCTACCAGTGTGGCTTGGTTTTGGCGCAGCGTTCAAGCATGTCTT
GCAGAAGGACATACGCAATCTTCAGATCCTTCAGGAGATGTACAACGAATGGCCATTTTT
CAGGGTTACAATAGACTTGGTTGAGATGGTGTTTGCTAAGGGTGATCCTGGTATAGCAGC
TCTGTATGACAAGTTGCTAGTTTCTGAGGATTTGTGGCCATTTGGTGCTCGTCTTAGAGC
AAACTATGAAGAAACAAAGCAACTTCTTCTACAGGTTGCTGGACACAAAGACCTTCTGGA
GGGAGATCCTTACTTGAGGCAGAGACTGCGTATCCGTGATTCCTACATCACAGCGCTGAA
TGTTTGCCAAGCTTGCACGCTAAAGCGTATCAGGGACCCTGGCTTCCATGTAAGCCCCCG
AGCTCACCTCTCCAAGGACATAATGGACTCAGGGAAGCCAGCCGCTGAGCTTGTGAAGCT
GAACACAACAAGCGAGTACGGCCCAGGCCTCGAGGACACTCTCATCCTGACCATGAAGGG
CATCGCTGCTGGTATGCAGAACACTGGGTGAAGTAGAACTGGTTCGTTCTGATGGTGTGT
TATGGTGTCATGAATTAGTGTAGTTTGCACCTCTATGCAATCACTATTTGCAGTTTGCAC
CTCTGAACTCTATATGTAAATAAGGGGATGCTAAGCAACGTATAACTAAGACTGGTTATA
TCCATGGATATTACCTGTTTAGCATGTTATATATCGAACTCTTATGCTGTTCACC

CDS

2775 bp

>Os01t0758300-01 Similar to Phosphoenolpyruvate carboxylase, housekeeping isozyme (EC 4.1.1.31) (PEPCase).
ATGGCGCGCAATGCGGCGGACAAGGGGACGTCCATCGACGCGCAGCTGCGGATCCTGGCG
CCTAAGAAGCTCTCGGAGGACGACAAGCTTGTGGAGTACGACGCGCTGCTCCTCGATCGC
TTCCTCGACATCCTCCAGGATCTGCATGGGGAGGACATCAGGGAGACGGTTCAAGAATGC
TATGAATTAGCTGCTGAGTATGAAAGTAAGATTGCGTATCGTAGGAGGATAAAACTGAAG
AAGGGTGATTTTGCTGATGAAAACTCTGCTACAACTGAATCAAACTTTGAGGAGACCCTA
AAAAGGCTTGTTGGTGAGCTTAAGAAGTCCCCTCATGAGGTATTTGATGCTCTCAAGAAT
CAAACAATCGACCTGGTCCTGACAGCACATCCAACTCAGTCAGTCAGGAGGTCGCTGCTA
CAAAAGCATGGCAGGATAAGAAGTTGTTTAACAAAACTTTATGCAAAAGACATAACTCCA
GATGAGAAGCAGGAACTCGATGAAGCACTTAAGAGAGAGATCCAAGCCGCCTTTAGAACA
GATGAAATTCGGCGAGCACCTCCTACACCACAGGATGAAATGCGTGCTGGAATGAGTTAT
TTTCATGAGACAATATGGAAGGGTGTACCCAAGTTTTTACGTAGGGTTGATACTGCCCTT
AAGAACATTGGCATAAACGAGCGAGTGCCCTATAATGCTCCTCTTATTCAATTTTCTTCT
TGGATGGGTGGAGACCGTGATGGAAATCCAAGAGTCACACCAGAGGTTACAAGGGACGTA
TGCCTGTTAGCTAGAATGATGGCTGCTAACTTATACTATGCACAGATAGAGGATCTGATG
TTTGAGCTATCTATGTGGCGCTGTAGTGATGAACTACGTGTAAAAGCTGATCAGTTACAC
CGTTGCGCAAAGAAAAACACAACAAAGCACTATATAGAGTTCTGGAAACAAGTTCCTCCG
AGTGAACCCTATCGTGTAATACTGAGCAATGTCAGAGATAAGTTGTACAATACACGCGAG
CGAGCACGCCATTTATTAGCCAGTGGATTTTCTGAAATTCCTGACGAAGCAACATTCACT
GATGTTGAGCAGTTCTTGGAGCCTCTTGAGCTCTGTTACAGGTCTCTCTGTGCCTGTGGT
GATAATTCTATTGCAGATGGCAGTCTTCTTGACTTTCTACGGCAAGTGTCCACATTTGGA
CTATCCCTTGTTAGACTTGATATTAGGCAAGAATCTGACCGACATACTGATGTTATGGAT
GCCATAACTCAATACCTTGGAATTGGATCCTATCGTGAATGGTCAGAGGAGAAACGCCAA
GAATGGCTTCTGTCAGAACTCAATGGAAAGAGGCCATTATTTGGTCCTGACCTTCCCCAG
ACGGATGAAATTGCTGATGCCCTAGATACTTTTCATGTGATAGCAGAACTACCCTATGAT
AGCTTTGGTGCATATGTAATATCCATGGCAACAGCTCCTTCAGATGTTCTAGCAGTTGAG
CTTCTGCAACGTGAATGTCATGTGAAGAAGCCACTGAGAGTTGTGCCATTGTTTGAAAAA
CTAGCAGATCTGGAAGCAGCACCAGCAGCTCTTGCCCGACTTTTCTCTGTTGACTGGTAC
AGAAATAGGATCGACGGAAAGCAGGAAGTAATGATTGGGTATTCAGATTCTGGAAAAGAT
GCTGGCCGTTTCTCTGCAGCTTGGGAACTGTATAAAGCTCAAGAGGAGCTTATTAAAGTT
GCTAAGCAGTTTGGGGTTAAGTTGACTATGTTTCATGGGCGAGGTGGAACTGTTGGAAGA
GGTGGGGGTCCTACACACCTTGCTATACTGTCACAACCTCCAGATACCATTCATGGATCA
CTTCGTGTGACTGTTCAAGGTGAAGTCATTGAGCAATCTTTTGGAGAGGAGCATTTGTGT
TTTAGGACACTTCAACGTTTTACATCTGCTACTCTTGAGCATGGTATGCATCCACCAATT
TCACCAAAGCCAGAATGGCGTGCTTTGATGGATGAAATGGCCGCTGTTGCTACAAAAGAA
TACCGGTCCATTGTCTTCCAAGAGGCACGATTTGTTGAATATTTCCGCCTTGCAACACCA
GAGTTGGAATATGGTAGGATGAATATTGGAAGTAGGCCATCAAAACGAAAGCCTAGTGGA
GGCATTGAATCACTTCGTGCAATTCCTTGGATCTTTGCTTGGACACAAACTCGATTCCAC
CTACCAGTGTGGCTTGGTTTTGGCGCAGCGTTCAAGCATGTCTTGCAGAAGGACATACGC
AATCTTCAGATCCTTCAGGAGATGTACAACGAATGGCCATTTTTCAGGGTTACAATAGAC
TTGGTTGAGATGGTGTTTGCTAAGGGTGATCCTGGTATAGCAGCTCTGTATGACAAGTTG
CTAGTTTCTGAGGATTTGTGGCCATTTGGTGCTCGTCTTAGAGCAAACTATGAAGAAACA
AAGCAACTTCTTCTACAGGTTGCTGGACACAAAGACCTTCTGGAGGGAGATCCTTACTTG
AGGCAGAGACTGCGTATCCGTGATTCCTACATCACAGCGCTGAATGTTTGCCAAGCTTGC
ACGCTAAAGCGTATCAGGGACCCTGGCTTCCATGTAAGCCCCCGAGCTCACCTCTCCAAG
GACATAATGGACTCAGGGAAGCCAGCCGCTGAGCTTGTGAAGCTGAACACAACAAGCGAG
TACGGCCCAGGCCTCGAGGACACTCTCATCCTGACCATGAAGGGCATCGCTGCTGGTATG
CAGAACACTGGGTGA

Protein

925 aa

>Os01t0758300-01 Similar to Phosphoenolpyruvate carboxylase, housekeeping isozyme (EC 4.1.1.31) (PEPCase).
MARNAADKGTSIDAQLRILAPKKLSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC
YELAAEYESKIAYRRRIKLKKGDFADENSATTESNFEETLKRLVGELKKSPHEVFDALKN
QTIDLVLTAHPTQSVRRSLLQKHGRIRSCLTKLYAKDITPDEKQELDEALKREIQAAFRT
DEIRRAPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSS
WMGGDRDGNPRVTPEVTRDVCLLARMMAANLYYAQIEDLMFELSMWRCSDELRVKADQLH
RCAKKNTTKHYIEFWKQVPPSEPYRVILSNVRDKLYNTRERARHLLASGFSEIPDEATFT
DVEQFLEPLELCYRSLCACGDNSIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMD
AITQYLGIGSYREWSEEKRQEWLLSELNGKRPLFGPDLPQTDEIADALDTFHVIAELPYD
SFGAYVISMATAPSDVLAVELLQRECHVKKPLRVVPLFEKLADLEAAPAALARLFSVDWY
RNRIDGKQEVMIGYSDSGKDAGRFSAAWELYKAQEELIKVAKQFGVKLTMFHGRGGTVGR
GGGPTHLAILSQPPDTIHGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTSATLEHGMHPPI
SPKPEWRALMDEMAAVATKEYRSIVFQEARFVEYFRLATPELEYGRMNIGSRPSKRKPSG
GIESLRAIPWIFAWTQTRFHLPVWLGFGAAFKHVLQKDIRNLQILQEMYNEWPFFRVTID
LVEMVFAKGDPGIAALYDKLLVSEDLWPFGARLRANYEETKQLLLQVAGHKDLLEGDPYL
RQRLRIRDSYITALNVCQACTLKRIRDPGFHVSPRAHLSKDIMDSGKPAAELVKLNTTSE
YGPGLEDTLILTMKGIAAGMQNTG*

5'UTR

chr01:31864995..31865031 (- strand) : 37 bp

chr01:31864873..31864911 (- strand) : 39 bp

CDS

chr01:31864705..31864872 (- strand) : 168 bp

chr01:31863833..31863874 (- strand) : 42 bp

chr01:31863483..31863706 (- strand) : 224 bp

chr01:31863157..31863241 (- strand) : 85 bp

chr01:31862794..31863016 (- strand) : 223 bp

chr01:31862608..31862711 (- strand) : 104 bp

chr01:31862436..31862526 (- strand) : 91 bp

chr01:31861826..31861980 (- strand) : 155 bp

chr01:31860743..31861741 (- strand) : 999 bp

chr01:31860149..31860535 (- strand) : 387 bp

chr01:31859538..31859834 (- strand) : 297 bp

3'UTR

chr01:31859334..31859537 (- strand) : 204 bp

FASTA

>Os01t0758300-01 class=Sequence position=chr01:31859334..31865031 (- strand)
GCATTGGCCG TTCGGATCGC GGTGGCGCTT CGTGAAGGTG TTGGGTTTCG CCGGATTGGA GGCTGAATTG GTGTACGCTG
GCTCCTCGTG GGGTATTAAT CTGCGGTTTT GGTGTTGCAG GTGGGGGAGA AGGGGGAAAA GGAGTCGGCT TTCGGGGAGA
TGGCGCGCAA TGCGGCGGAC AAGGGGACGT CCATCGACGC GCAGCTGCGG ATCCTGGCGC CTAAGAAGCT CTCGGAGGAC
GACAAGCTTG TGGAGTACGA CGCGCTGCTC CTCGATCGCT TCCTCGACAT CCTCCAGGAT CTGCATGGGG AGGACATCAG
GGAGACGGTA AATGATCCCC CGATCGCTCC ATGCCATAAT GCATTTTGGT TTCTCCTTAT TTTTCTCTTG TTGATCTGGG
TGGGGTGAGT ACTGCATGCT CGAAGATCGC TTTGTGCGCA AATCGGAGGT GGTTTGGCCA CTTATCTTAA GGCATTTTGG
ATTTGTGTGT TTCACTGATT TTATTCTCTG CATGTTATAT TATTTGCATG TTTTATGCGC TTTGGTAGTG GAAATGTTAT
TTTTTTAAAA AAAACATAGT GTCAAATCCT TTCTTCTGTT GTCATCTCCG TTTTCCTGGA ATTGTACTCT CGTATGCAAC
TCATGTTTTA GCCAGGGAGT AGATTGCCAT GCTGTTCAAA GTAGTAGCTA TGCAAAGATG GGCGGATCGC TTGCTGTCAT
TGCGACTTTC CGATGGTCCA GTGGAATTAC GCCCCTTTAT TTGAGGAATG GGGTCTTGTT ATAACCTTTT GTTATTGTTG
ATATGTTGCA GTCTGTGAAC AAATGTGTCA CGATTTGTTA ATGGTGTATA GTTTTCCATA CTTCTACCTT CATCTTGTTT
CTGTATGTTG TTCTACATGA TTTCACTGTG CAGTTTCGAC ATCATTGAGT TGTCTGGACA CGTGTTGGCT AATCCAGTCA
AGCAATCTAT AAAACTATGA GGCCTGCGAG TGTTCTGCTA GTATCATTGA GTTTTTGTGT CATCTGTTTG CTATACCGTT
GCGCTGATTT TTTTTAATGA ATAGCTTGAT TCTTTCAATT TCTGCAATAT AATGAGCTTT CTTCAATTAA ACATCTATAA
TGTGTTCAAA ATTTTGCACT TCTGTTGGTA TATGTAGGTT CAAGAATGCT ATGAATTAGC TGCTGAGTAT GAAAGTAAGG
TTGACCCCAA ACAGCTGGAT GCAATTGGGA ATGTGTTAAC TCGTTTAGAT CCTGGAGACT CCATTGTGAT GACGAAGTCA
TTCTCACACA TGCTTATCCT GGCAAACTTG GCTGAGGAGG TCCAGATTGC GTATCGTAGG AGGATAAAAC TGAAGAAGGG
TGATTTTGCT GATGAAAACT CTGCTACAAC TGAATCAAAC TTTGAGGAGA CCCTAAAAAG GCTTGTTGGT GAGCTTAAGA
AGTCCCCTCA TGAGGTATTT GATGCTCTCA AGAATCAAAC AATCGACCTG GTCCTGACAG CACATCCAAC TCAGTCAGTC
AGGAGGTCGC TGCTACAAAA GCATGGCAGG TTAGTTTCAA TTTTTGCACA ACCAAAATAA ATATAGCCAA TAAAAGGGCA
TTTGAAATGA GTGGAATGCA ACTGCATTGC ATCCTGCATT GTCTTTAGTT GTTAAGTATA ATATTTGTTC AATGCACTAG
AGAAGTTCAG TTCACTAAGA ATGCTTGCTA GATGCAAGGT TTGTCGGATT CGACAAATCT ATCTTTCAAG TGTTGAACAA
AATATAAGGT TTTCACTTTC CTATATGCAG GATAAGAAGT TGTTTAACAA AACTTTATGC AAAAGACATA ACTCCAGATG
AGAAGCAGGA ACTCGATGAA GCACTTAAGA GAGAGGTGAT TTCCTTTTTG TAGGAGCTTG GATTATGAGT GGCACAAGAC
CACTATAGTG ATTATTTCAA CAATCAGCAA GATTTGTCAT ACATCAAAAA TATATTTATA TGATTCTAAT TCCTTATATT
TTTTCTTATG TTCAGATCCA AGCCGCCTTT AGAACAGATG AAATTCGGCG AGCACCTCCT ACACCACAGG ATGAAATGCG
TGCTGGAATG AGTTATTTTC ATGAGACAAT ATGGAAGGGT GTACCCAAGT TTTTACGTAG GGTTGATACT GCCCTTAAGA
ACATTGGCAT AAACGAGCGA GTGCCCTATA ATGCTCCTCT TATTCAATTT TCTTCTTGGA TGGGTGGAGA CCGTGATGGT
ATGTTACATC TATCATATCA TGTTTGCAAC ATAGTTAATT AATTGTGAAA TTATGGTTTT AATATTGATG TGGACTACAG
GAAATCCAAG AGTCACACCA GAGGTTACAA GGGACGTATG CCTGTTAGCT AGAATGATGG CTGCTAACTT ATACTATGCA
CAGATAGAGG ATCTGATGTT TGAGGTAAAA ATAATAGGTT GTACTATTTA AAGGATATAT GCTGTATTGA TGTTTGATCT
CACACAAAAT TTTGACCACC TGCAGCTATC TATGTGGCGC TGTAGTGATG AACTACGTGT AAAAGCTGAT CAGTTACACC
GTTGCGCAAA GAAAAACACA ACAAAGCACT ATATAGGTAT GTATCACGTA TGGAATCATT ACAGTTTAGT TCTGCACACC
TTATTTCTAT TATAAGTGGC CTTATTTATC ATCCCCTTCC AAATAGGTTT ACCAAATTAG TCTTCACCCC ATAATTAATA
TAATTATTAC GTATGTTACC GATAATCATC ATGAGGATTC TCGAAGGATT AAACTTTAAT GAAAATTCAT CATCTAAATC
ATTTAATAAT AAGAAAAACA TAAAAGGATA AGTCCCACAT GATTACCGTG GCAGTTTCTT GCCTCTTTTT TTTTCATTTC
TTTCATGTGG TTAATTTTTG GAGTCCTACA TGTGAACTTT AGAACATACC ACTAGCATTG GTCCCAAATT GTTCCACGTT
AGCTTTACTG TGTTTTTCCC TTTCCTTTTT TTACAACTGT GATATATTAG GTGGAGTGAA ATGCATGCTG ATATGCTTCT
CTTGAATGCA GAGTTCTGGA AACAAGTTCC TCCGAGTGAA CCCTATCGTG TAATACTGAG CAATGTCAGA GATAAGTTGT
ACAATACACG CGAGCGAGCA CGCCATTTAT TAGCCAGTGG ATTTTCTGAA ATTCCTGACG AAGCAACATT CACTGATGTT
GAGCAGGTAC ATAGGCTAAG ATACAAAAAA CTTGCTTACT ATGCTATACG TTTTGGTTGT CCTTCTGGTT GAAGGTTTCT
TCTTTTGCAG TTCTTGGAGC CTCTTGAGCT CTGTTACAGG TCTCTCTGTG CCTGTGGTGA TAATTCTATT GCAGATGGCA
GTCTTCTTGA CTTTCTACGG CAAGTGTCCA CATTTGGACT ATCCCTTGTT AGACTTGATA TTAGGCAAGA ATCTGACCGA
CATACTGATG TTATGGATGC CATAACTCAA TACCTTGGAA TTGGATCCTA TCGTGAATGG TCAGAGGAGA AACGCCAAGA
ATGGCTTCTG TCAGAACTCA ATGGAAAGAG GCCATTATTT GGTCCTGACC TTCCCCAGAC GGATGAAATT GCTGATGCCC
TAGATACTTT TCATGTGATA GCAGAACTAC CCTATGATAG CTTTGGTGCA TATGTAATAT CCATGGCAAC AGCTCCTTCA
GATGTTCTAG CAGTTGAGCT TCTGCAACGT GAATGTCATG TGAAGAAGCC ACTGAGAGTT GTGCCATTGT TTGAAAAACT
AGCAGATCTG GAAGCAGCAC CAGCAGCTCT TGCCCGACTT TTCTCTGTTG ACTGGTACAG AAATAGGATC GACGGAAAGC
AGGAAGTAAT GATTGGGTAT TCAGATTCTG GAAAAGATGC TGGCCGTTTC TCTGCAGCTT GGGAACTGTA TAAAGCTCAA
GAGGAGCTTA TTAAAGTTGC TAAGCAGTTT GGGGTTAAGT TGACTATGTT TCATGGGCGA GGTGGAACTG TTGGAAGAGG
TGGGGGTCCT ACACACCTTG CTATACTGTC ACAACCTCCA GATACCATTC ATGGATCACT TCGTGTGACT GTTCAAGGTG
AAGTCATTGA GCAATCTTTT GGAGAGGAGC ATTTGTGTTT TAGGACACTT CAACGTTTTA CATCTGCTAC TCTTGAGCAT
GGTATGCATC CACCAATTTC ACCAAAGCCA GAATGGCGTG CTTTGATGGA TGAAATGGCC GCTGTTGCTA CAAAAGAATA
CCGGTCCATT GTCTTCCAAG AGGCACGATT TGTTGAATAT TTCCGCCTTG TAAGTATTCT TTTTTTAATA ACTTCAGTTT
TTGTTTTATG CTTATAAAAA TACTGTTCAT TTTAAACCTT TTATGCTGTC TTGAAATAGC TATCTTGAAA TTGCAACTTC
ACTCTGTAGT CACCTTCATA AATTTGTTAT TTTGCTAATG ATTATTCTAA TGGTCTGTAT AAATAATCTC AATTTTGCTT
CTTTGCTGTC AAATAGGCAA CACCAGAGTT GGAATATGGT AGGATGAATA TTGGAAGTAG GCCATCAAAA CGAAAGCCTA
GTGGAGGCAT TGAATCACTT CGTGCAATTC CTTGGATCTT TGCTTGGACA CAAACTCGAT TCCACCTACC AGTGTGGCTT
GGTTTTGGCG CAGCGTTCAA GCATGTCTTG CAGAAGGACA TACGCAATCT TCAGATCCTT CAGGAGATGT ACAACGAATG
GCCATTTTTC AGGGTTACAA TAGACTTGGT TGAGATGGTG TTTGCTAAGG GTGATCCTGG TATAGCAGCT CTGTATGACA
AGTTGCTAGT TTCTGAGGAT TTGTGGCCAT TTGGTGCTCG TCTTAGAGCA AACTATGAAG AAACAAAGCA ACTTCTTCTA
CAGGTGATTT TCTAAGACGT TTTATCCATT TATATACCGC TAGATAGTAT AATTGCCTCC AATTGCTGGT GTTTTTGCTG
GCAACTGGTT GGTAATGTTT TCCTTCAATT TACCAAGCTG TATATCCTGC ATTTGTCTGA CTAAATGATC AAGCATCTTT
TATATATTGG CAATAATTAA GCTCCAGATA CTTCTAGAAA ATGCTGCACA GAAATGTATC TCCAAATTAG TGTCTAAAAA
ACATATTTAT CACTAGTCCC GAACTACTGA TCTTTTTTTT TAACTATATC TGCCCACTCA CTGCTATGTG AACTCAGGTT
GCTGGACACA AAGACCTTCT GGAGGGAGAT CCTTACTTGA GGCAGAGACT GCGTATCCGT GATTCCTACA TCACAGCGCT
GAATGTTTGC CAAGCTTGCA CGCTAAAGCG TATCAGGGAC CCTGGCTTCC ATGTAAGCCC CCGAGCTCAC CTCTCCAAGG
ACATAATGGA CTCAGGGAAG CCAGCCGCTG AGCTTGTGAA GCTGAACACA ACAAGCGAGT ACGGCCCAGG CCTCGAGGAC
ACTCTCATCC TGACCATGAA GGGCATCGCT GCTGGTATGC AGAACACTGG GTGAAGTAGA ACTGGTTCGT TCTGATGGTG
TGTTATGGTG TCATGAATTA GTGTAGTTTG CACCTCTATG CAATCACTAT TTGCAGTTTG CACCTCTGAA CTCTATATGT
AAATAAGGGG ATGCTAAGCA ACGTATAACT AAGACTGGTT ATATCCATGG ATATTACCTG TTTAGCATGT TATATATCGA
ACTCTTATGC TGTTCACC