Os01t0940100-01

Locus

Os01g0940100

Description

Similar to Hexokinase.

Transcript Evidence

AK107602 (DDBJ, Best hit)

Protein Evidence

Q2KNB4 (UniProt)

CGSNL Gene Symbol

HXK3

CGSNL Gene Name

HEXOKINASE-3

CGSNL Gene Symbol Synonym(s)

OsHXK3

CGSNL Gene Name Synonym(s)

Hexokinase 3

Literature (PMID)

Manual Curation

Note

GO

Biological Process: carbohydrate metabolic process (GO:0005975)

Biological Process: glycolysis (GO:0006096)

Molecular Function: hexokinase activity (GO:0004396)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: phosphotransferase activity, alcohol group as acceptor (GO:0016773)

InterPro

Hexokinase (IPR001312)

Hexokinase, conserved site (IPR019807)

Hexokinase, N-terminal (IPR022672)

Hexokinase, C-terminal (IPR022673)

KEGG

Os01t0940100-01 (EC:2.7.1.1)

KOME

002-131-B07 (Online Clone Ordering)

RiceXPro Database

AK107602

Oryzabase

9004

Plant Gene Family Database (PGFD)

Os01t0940100-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os01t0940100-01

Transcript

1181 bp

>Os01t0940100-01 Similar to Hexokinase.
AACTTTGTTGCCCTGGCACTAAAGAATTTTCTTGAAGGAGAAGATGACCAAGATGGAAAA
ATGGCACTTGGTTTTACATTTTCTTTCCCTGTTAGACAAATTTCAGTGTCTTCAGGGTCA
TTAATTAGGTGGACAAAAGGATTTTCCATCAGAGACACGGTTGGCAGAGATGTTGCTCAG
TGCTTAAATGAAGCGCTTGCCAATTGTGGGCTAAATGTGCGGGTCACTGCATTGGTGAAT
GATACAGTGGGGACATTAGCTCTAGGGCATTACTATGATGAAGACACAGTGGCTGCTGTG
ATAATTGGGTCTGGCACCAACGCTTGCTACATTGAACGCACTGATGCAATTATCAAGTGC
CAGGGTCTTCTAACGAACTCTGGAGGCATGGTAGTAAACATGGAGTGGGGGAATTTCTGG
TCATCACATTTGCCAAGGACGCCATATGACATCTTGCTGGATGATGAAACACACAATCGC
AATGATCAGGGCTTTGAGAAAATGATATCAGGAATGTATCTTGGGGAAATTGCAAGATTG
GTATTTCATAGAATGGCCCAGGAATCAGATGTTTTTGGTGATGCTGCTGATAGTCTATCC
AACCCTTTCATTTTGAGCACACCGTTTCTGGCCGCAATTCGCGAGGACGATTCACCAGAT
CTGAGCGAAGTCAGAAGGATACTTCGAGAACATCTGAAGATTCCCGATGCTCCTCTGAAA
ACTCGACGGCTGGTCGTGAAAGTCTGCGACATTGTGACTCGCAGAGCCGCCCGTCTAGCC
GCTGCAGGCATCGTGGGGATACTGAAGAAGCTGGGGAGGGATGGGAGCGGCGCGGCGTCG
AGCGGGAGAGGTAGAGGGCAGCCGAGGAGGACGGTGGTGGCGATCGAGGGCGGGCTGTAC
CAGGGTTACCCGGTGTTCAGGGAGTACCTGGACGAGGCCCTGGTGGAGATCCTGGGGGAG
GAGGTGGCGCGGAACGTGACGCTGAGGGTGACGGAGGATGGGTCGGGGGTCGGGGCTGCC
CTCCTCGCCGCCGTACATTCGTCGAATAGACAGCAACAAGGAGGTCCCATATAGTGAGAG
AGACAATGAAGATACAGCTAGCCCCTCTTGTTCAAATGTAAAAAAGGGACATTGTTTGAT
ATCTATATTCATATATATAAAAATCTGGGTCTTGTGCAGAG

CDS

1074 bp

>Os01t0940100-01 Similar to Hexokinase.
AACTTTGTTGCCCTGGCACTAAAGAATTTTCTTGAAGGAGAAGATGACCAAGATGGAAAA
ATGGCACTTGGTTTTACATTTTCTTTCCCTGTTAGACAAATTTCAGTGTCTTCAGGGTCA
TTAATTAGGTGGACAAAAGGATTTTCCATCAGAGACACGGTTGGCAGAGATGTTGCTCAG
TGCTTAAATGAAGCGCTTGCCAATTGTGGGCTAAATGTGCGGGTCACTGCATTGGTGAAT
GATACAGTGGGGACATTAGCTCTAGGGCATTACTATGATGAAGACACAGTGGCTGCTGTG
ATAATTGGGTCTGGCACCAACGCTTGCTACATTGAACGCACTGATGCAATTATCAAGTGC
CAGGGTCTTCTAACGAACTCTGGAGGCATGGTAGTAAACATGGAGTGGGGGAATTTCTGG
TCATCACATTTGCCAAGGACGCCATATGACATCTTGCTGGATGATGAAACACACAATCGC
AATGATCAGGGCTTTGAGAAAATGATATCAGGAATGTATCTTGGGGAAATTGCAAGATTG
GTATTTCATAGAATGGCCCAGGAATCAGATGTTTTTGGTGATGCTGCTGATAGTCTATCC
AACCCTTTCATTTTGAGCACACCGTTTCTGGCCGCAATTCGCGAGGACGATTCACCAGAT
CTGAGCGAAGTCAGAAGGATACTTCGAGAACATCTGAAGATTCCCGATGCTCCTCTGAAA
ACTCGACGGCTGGTCGTGAAAGTCTGCGACATTGTGACTCGCAGAGCCGCCCGTCTAGCC
GCTGCAGGCATCGTGGGGATACTGAAGAAGCTGGGGAGGGATGGGAGCGGCGCGGCGTCG
AGCGGGAGAGGTAGAGGGCAGCCGAGGAGGACGGTGGTGGCGATCGAGGGCGGGCTGTAC
CAGGGTTACCCGGTGTTCAGGGAGTACCTGGACGAGGCCCTGGTGGAGATCCTGGGGGAG
GAGGTGGCGCGGAACGTGACGCTGAGGGTGACGGAGGATGGGTCGGGGGTCGGGGCTGCC
CTCCTCGCCGCCGTACATTCGTCGAATAGACAGCAACAAGGAGGTCCCATATAG

Protein

358 aa

>Os01t0940100-01 Similar to Hexokinase.
NFVALALKNFLEGEDDQDGKMALGFTFSFPVRQISVSSGSLIRWTKGFSIRDTVGRDVAQ
CLNEALANCGLNVRVTALVNDTVGTLALGHYYDEDTVAAVIIGSGTNACYIERTDAIIKC
QGLLTNSGGMVVNMEWGNFWSSHLPRTPYDILLDDETHNRNDQGFEKMISGMYLGEIARL
VFHRMAQESDVFGDAADSLSNPFILSTPFLAAIREDDSPDLSEVRRILREHLKIPDAPLK
TRRLVVKVCDIVTRRAARLAAAGIVGILKKLGRDGSGAASSGRGRGQPRRTVVAIEGGLY
QGYPVFREYLDEALVEILGEEVARNVTLRVTEDGSGVGAALLAAVHSSNRQQQGGPI*

CDS

chr01:41310977..41311135 (- strand) : 159 bp

chr01:41308350..41308424 (- strand) : 75 bp

chr01:41306920..41307075 (- strand) : 156 bp

chr01:41306700..41306798 (- strand) : 99 bp

chr01:41306491..41306618 (- strand) : 128 bp

chr01:41306289..41306370 (- strand) : 82 bp

chr01:41305825..41306199 (- strand) : 375 bp

3'UTR

chr01:41305718..41305824 (- strand) : 107 bp

FASTA

>Os01t0940100-01 class=Sequence position=chr01:41305718..41311135 (- strand)
AACTTTGTTG CCCTGGCACT AAAGAATTTT CTTGAAGGAG AAGATGACCA AGATGGAAAA ATGGCACTTG GTTTTACATT
TTCTTTCCCT GTTAGACAAA TTTCAGTGTC TTCAGGGTCA TTAATTAGGT GGACAAAAGG ATTTTCCATC AGAGACACGG
TATGGCAAAA TTTTTTCCTT GCTAGTTATC ATATGGTTCA GTTTAATTTC CACATTGATG TAGTTGTATA TAACCTACAC
AGCTAGTGGT TTTGGTAAAT ATTGTAAATT TTTCTATGGT TCAAGGTGAA TGCATAACTA GCTACCACTT TTTTGACTAT
CTTGTGTTAC TACATGAAAG AATATATACT TGTTACCTAC TAGAAATTTG TAATGATGAG TCCTATTTCT GTTTGtgtta
tgggttagga ttcatagggg gtaaacaccg ccgggaggat agccgggcgg cgacggctgc tagggatgag agggggactt
aggttgggag agactaacct tgattcattg cttaattaga atgatgatac aaaccatcct tatatagatg gagggaggac
ccagtctaat cctatccaac caactctatc cttatcccta gggcctcgac ccctcggccc actacctatg acactacatc
cctcctttcg agcagctcgc cctcgagctg cagcacaatt tagctgaccc aaacgactcc ctaaataaag ccttatatga
cttaagcctt ttacatctcg gcttattact ttatggcaaa ctgaaattga aaggataaat aaatcaaaga ttatgatgca
ccaccatgct atctcgccga catcagatgt aggtggaccc catcccaaag ctttgagaga aaggataagt ccatagcacg
ttgcaagctt gattgcacat ctaatctgtt ttccaaggtg gtttgtagat ggcacattca gattagctcc accggaccag
cacaacagcc atggtgccaa catttctagc ccacactgac tgcctaaggc ccaaggcata gttgaaggcc cttgtgttgt
aatttgtgga ccagcccact ggcccaagag ccaccaagat ggcttgatcg atctgctgat cccaccagga cgtgaaatct
tatccactga atgcaacgct gccggtagtt ggagccgcgc ttccgccgct cgtgggctgc gcaactgctg cgtcgtctcc
cacgcctccg cgcgcgacgc ccgccgagaa tcaagggcca cgccgcactt ccccaactgc cgcgcgcacg aatcgcgctg
ttgtgcgcgc cgcgttgcca ggagcccgcg ccaatgcgcc tgccgccttg ccgctcgctt cccaaaaaaa aaaccagccc
gcgtcttcgt ggcagccgga atcgccgtct tcgcctccga tgaccccagc agcggcggcg ccagcgccat agccaactgc
atgggcgagg gctacccgaa aatggcccct gctcctgcca acaaggatcc cccggccgcc ttgcttcagg gaaggttgtc
ccagaggaag caggtgcagc tgccctcggc cgcgcaccac gccgcgcgcc atggcttgcc ctgcaccctg acgacctgcc
tgaattacgc ttcttgaata catgctgtcg tgggcgcatg gatgatagat gatggcacga cacaatagcc tccattgggg
agggctgaga ggatggagcc gcggccagcg acggcattgc tgtgcccacc accgccgtct gcagattgca cttctcttcc
ttctcgattg gcgcatgctc cgtcctcatt gaggctgcaa gtaccgccag gtcgacctgc atccttttga ggatccggat
gcacatgtct ctaggatctt tgatcatatc ttcaacaacc atggctctga taccaagttg ttatgggtta ggatccatag
ggggtaaaca ccgccgagag gatagccggg cggcgacggc tgctagggat gagaggagga cttaggctgg gagagactaa
tcttgattca ttgcttaatt agaatgatga tacaaaccat ccttatatag atggagggag gacccagtct aatcctatcc
aaccaactct atccttatcc ctagggcctc gacccctcgg cccactacct atgacaGTCT GTTGGATATT TGTTGTGGTT
GCATAAACAg ggagcatatc ctatgcacac aggccctcgc gtgtacacac cgtgtacacc aactaaaaat tatcacaaaa
aattttagga aaattcatac atgtactttc aatagtatta catctacgtg caaagtcgca tcttcaaatt cattctacat
agagaataac aaaaaagata aaattctgac aaaattgcaa ccttaaaact gtcagatttt ttgtttattt tgttacggct
aaaatataat gaatttgacg ttaagatttt aaccctaggt gtaatacaat tgaaagtatg tgtatgattt tttctagttt
ttttggtgac attttttagt tggtgtgccc gtgtgtacac gtgagggcct gtgtgcatag gatatgttgc TGCATAAACA
TGCATGTGTA GCCGTTTCCC TCAACTTCCT AACTAAATTA TATTTTTATT TGAAGGAAAC ACATATTGCT TTGCTTTATT
TTCTGATTTC TTCTTTGCTT CGATCTGACA TACTGATTTT GAAACTGCTA CTGTGAATAA TGGAATCTTA GGTTGGCAGA
GATGTTGCTC AGTGCTTAAA TGAAGCGCTT GCCAATTGTG GGCTAAATGT GCGGGTCACT GCATTGGTAA GTCTTTTGCA
ACCGTTTTTT TGGTGGGTGT AACTCTGTTA CATTTATACC ATTGAATACA TTTTCTTGGC TTGAAAGTAC TGTTATAGTG
CTTGTTCACT ACTAGTGTGG AGCTTagata catacttcct ccgtttcata ttataagact ttctagcatt gcccacattc
atatactccc tccgtttcac aatgtaagtc attctagcat ttcccacatt catattgatg ctaatgaatc tagacatata
tacctatcta gattcattag tatcaatatg aatgtattca ttaatatcaa tatgaatgtg ggaaattcta gaatgactta
cattgtgaaa cggagggagt atatgttaat gaatctagac atatatgtgt gtctagattc attaatatct atatgaatgt
gggcaatgct agaaagtctt ataacctTTT TTTTTGATCT CAAGTCTTGT AACCTGAAAC AGAGGTAGTA GTCAATAAGA
AATGCATTCA AAAGATGACG CTTGCCATCG AGGAATTTGA AATGAAAAAT CCGAAGGGTG ACCCTCTAGT TCTTCTGTCG
GGGTTGGTCT AGCTGTGACA GCCTTTCTTT CCCAGTGTTC AGTTCATAGT TATGAATTTG CTTGTAGAGT GCAAGCAGTG
TTCTAGATAA GGGAACAGAG CTGGTAAATA AAGTAAAAAC GGATGTACAC AGATATATAC TGATCATGTG TGTATCAGTA
Atactccctc cgtcccaaaa taagtgcagc catggttttc cacgcccaac tttgaccgtt cgtcttattt gaattttttt
ttaaaaaaat taaaaacata agtcacgagt aaagtactat tcatgtttta tcatctcata acaacaaaaa tgttaattat
aaattttttt taaataagac ggacgatcga agttgggcgc ggaaactcat ggctgcactt attttgggac ggaggtagta
GCATTTTTTT GGGGTAGTGA CCAGCTTCAG AGATGCTTGT TATCAGCATG TTATGTTCAA AACACAGAAT AATCCTTGCT
GCTAGAAACC TTCACTCAAA TCAAGAGGAC AATGCCATGA TTATAGGGGT AGTGCAGTAA TAGTATTGGT GTCATGGCCT
GATACTATAC CCTTGTTCTG TTTGGGATGG CTGCTGGTGT TTGGCCCAAT GAAGTATAAT GCCATTGTGT TATATTTTTA
TTATATTTTG TTGAGGAGTG CCTTTTAAAT GATTATTCTT TTATGCTACT TTGTACTTAG GTGAATGATA CAGTGGGGAC
ATTAGCTCTA GGGCATTACT ATGATGAAGA CACAGTGGCT GCTGTGATAA TTGGGTCTGG CACCAACGCT TGCTACATTG
AACGCACTGA TGCAATTATC AAGTGCCAGG GTCTTCTAAC GAACTCTGGA GGCATGGTAT CTTATTTTCT CCTTTATCTG
TAGTCAGTTC AATTTCCTTG TCAAATGCTC ATCAGCTTAT GTGGAGTAAA GGAATTATGA TGCCCATGTG CGTACCCTAA
AACATTTCGT TAATCAGGTA GTAAACATGG AGTGGGGGAA TTTCTGGTCA TCACATTTGC CAAGGACGCC ATATGACATC
TTGCTGGATG ATGAAACACA CAATCGCAAT GATCAGGTAG CAACCTGGGT AAAATTCAAT TATTCTGGTA TCTTGTGTTG
TGGTTTAGAC TGAACACTTT GTACTACCAT GATTCAGGGC TTTGAGAAAA TGATATCAGG AATGTATCTT GGGGAAATTG
CAAGATTGGT ATTTCATAGA ATGGCCCAGG AATCAGATGT TTTTGGTGAT GCTGCTGATA GTCTATCCAA CCCTTTCATT
TTGAGGTATG TCCGGATGTC AAATTCTACT GATGTTTGTT TCGTACCTGG TGTATTTCTG CATAAACACA ATTAGTAAAA
AGAAGTTGTT CTATGTGTTG TCTGATTTCA ATTTTGCAAA TCCAGCACAC CGTTTCTGGC CGCAATTCGC GAGGACGATT
CACCAGATCT GAGCGAAGTC AGAAGGATAC TTCGAGAACA TCTGAAGGTT AGCTCAGAAT TATTCCAGCC ATTTCATCGG
GCACCATTCT TTTTTCCATT CCATCCATCT AGTTGTCTGA TGATTCTCTC TTCCAGATTC CCGATGCTCC TCTGAAAACT
CGACGGCTGG TCGTGAAAGT CTGCGACATT GTGACTCGCA GAGCCGCCCG TCTAGCCGCT GCAGGCATCG TGGGGATACT
GAAGAAGCTG GGGAGGGATG GGAGCGGCGC GGCGTCGAGC GGGAGAGGTA GAGGGCAGCC GAGGAGGACG GTGGTGGCGA
TCGAGGGCGG GCTGTACCAG GGTTACCCGG TGTTCAGGGA GTACCTGGAC GAGGCCCTGG TGGAGATCCT GGGGGAGGAG
GTGGCGCGGA ACGTGACGCT GAGGGTGACG GAGGATGGGT CGGGGGTCGG GGCTGCCCTC CTCGCCGCCG TACATTCGTC
GAATAGACAG CAACAAGGAG GTCCCATATA GTGAGAGAGA CAATGAAGAT ACAGCTAGCC CCTCTTGTTC AAATGTAAAA
AAGGGACATT GTTTGATATC TATATTCATA TATATAAAAA TCTGGGTCTT GTGCAGAG