Os01t0949700-01

Locus

Os01g0949700

Description

Glutathione S-transferase, C-terminal domain containing protein.

Transcript Evidence

AK069037 (DDBJ, Best hit)

Protein Evidence

Q10HA8 (UniProt)

CGSNL Gene Symbol

GSTU7

CGSNL Gene Name

TAU GLUTATHIONE S-TRANSFERASE 7

CGSNL Gene Symbol Synonym(s)

OsGSTU7

CGSNL Gene Name Synonym(s)

Literature (PMID)

Manual Curation

Note

GO

Molecular Function: protein binding (GO:0005515)

InterPro

Glutathione S-transferase, N-terminal (IPR004045)

Glutathione S-transferase, C-terminal (IPR004046)

Glutathione S-transferase, C-terminal-like (IPR010987)

Thioredoxin-like fold (IPR012336)

Glutathione S-transferase/chloride channel, C-terminal (IPR017933)

KEGG

Os01t0949700-01

KOME

J023004F17 (Online Clone Ordering)

RiceXPro Database

AK069037

Oryzabase

9525

Plant Gene Family Database (PGFD)

Os01t0949700-01

Transcript

1146 bp

>Os01t0949700-01 Glutathione S-transferase, C-terminal domain containing protein.
GAGTAGAAGCTGAACAGATTGGCAGaagcagaagcagaagcaaaagatgatgaattcatc
tgagccggtgaagctgatcggcgctttcggcagcccgttcgtccaccgtgtcgaggtcgc
cctgcgcctgaaaggagtgccctacgagctcatcctcgaggacatgggcaacaagagcga
gctcctcctcgcgcacaaccccgtccacaagatggtccccgtgctcctccacggcgaccg
ctccgccatctgcgagtcgctggtcatcgtcgagtacgtcgacgaggcgttcgacgggcc
gcccctcctccccgccgaccccctccgccgcgccatggcccgcttctgggttcacttcct
cgacGAAAATtgcctgaagccgttgcggccggcgctgttcggggaaggcgaggagcagaa
gaaatccatggaggagacacgggagggcctgacggtggcggaggcggagctcaggggcaa
gcggttctccggaggcagctccatcggcctcgccgacatcgccggcggtggcgtgctggc
tcactgggtcggcgtgctccaagaggtcgccggagtgagcgtcctgagcgacggcgacgg
cgagtaccctgctctgcgccggtgggcgaaggattacgtcgctaatgaatccgtgatgga
gtgcttgccggatagagatcggctcctctcctacttcaccgggatcaagcagaagtgcgt
ttcggtggccaagtctacgctgccaaaGtactcccttcttccctaaatatttacgcagtt
gacttttttaaatatatttaactgttcgtcttatttaaaaacttttgtgaaatatgtaat
attatatatatacataaaagtatatttaacaataaattaaatgatagaaaaagaattaat
aattacttaaatttttcaaataagacgaacggttaaatatttttaaaaaagtcaacggcg
tcaaatattttgggatggagggagtaGTTACTAGTGATGAACGAATAAACTAATAGCGGC
GTGCACCTTGTGGCTAATTGAGTTTCGTCTTTCTTGTCGACGTGTTATTGTGTTGTCTCT
GTTTGTCACATGCACGTTTGACCGTATGTACGATTAATCTTTCGTCATGATACAGTACGA
GCAAGG

CDS

720 bp

>Os01t0949700-01 Glutathione S-transferase, C-terminal domain containing protein.
atgatgaattcatctgagccggtgaagctgatcggcgctttcggcagcccgttcgtccac
cgtgtcgaggtcgccctgcgcctgaaaggagtgccctacgagctcatcctcgaggacatg
ggcaacaagagcgagctcctcctcgcgcacaaccccgtccacaagatggtccccgtgctc
ctccacggcgaccgctccgccatctgcgagtcgctggtcatcgtcgagtacgtcgacgag
gcgttcgacgggccgcccctcctccccgccgaccccctccgccgcgccatggcccgcttc
tgggttcacttcctcgacGAAAATtgcctgaagccgttgcggccggcgctgttcggggaa
ggcgaggagcagaagaaatccatggaggagacacgggagggcctgacggtggcggaggcg
gagctcaggggcaagcggttctccggaggcagctccatcggcctcgccgacatcgccggc
ggtggcgtgctggctcactgggtcggcgtgctccaagaggtcgccggagtgagcgtcctg
agcgacggcgacggcgagtaccctgctctgcgccggtgggcgaaggattacgtcgctaat
gaatccgtgatggagtgcttgccggatagagatcggctcctctcctacttcaccgggatc
aagcagaagtgcgtttcggtggccaagtctacgctgccaaaGtactcccttcttccctaa

Protein

240 aa

>Os01t0949700-01 Glutathione S-transferase, C-terminal domain containing protein.
MMNSSEPVKLIGAFGSPFVHRVEVALRLKGVPYELILEDMGNKSELLLAHNPVHKMVPVL
LHGDRSAICESLVIVEYVDEAFDGPPLLPADPLRRAMARFWVHFLDENCLKPLRPALFGE
GEEQKKSMEETREGLTVAEAELRGKRFSGGSSIGLADIAGGGVLAHWVGVLQEVAGVSVL
SDGDGEYPALRRWAKDYVANESVMECLPDRDRLLSYFTGIKQKCVSVAKSTLPKYSLLP*

5'UTR

chr01:41839952..41839997 (+ strand) : 46 bp

CDS

chr01:41839998..41840321 (+ strand) : 324 bp

chr01:41840665..41841060 (+ strand) : 396 bp

3'UTR

chr01:41841061..41841440 (+ strand) : 380 bp

FASTA

>Os01t0949700-01 class=Sequence position=chr01:41839952..41841440 (+ strand)
GAGTAGAAGC TGAACAGATT GGCAGaagca gaagcagaag caaaagatga tgaattcatc tgagccggtg aagctgatcg
gcgctttcgg cagcccgttc gtccaccgtg tcgaggtcgc cctgcgcctg aaaggagtgc cctacgagct catcctcgag
gacatgggca acaagagcga gctcctcctc gcgcacaacc ccgtccacaa gatggtcccc gtgctcctcc acggcgaccg
ctccgccatc tgcgagtcgc tggtcatcgt cgagtacgtc gacgaggcgt tcgacgggcc gcccctcctc cccgccgacc
ccctccgccg cgccatggcc cgcttctggg ttcacttcct cgacGAAAAT GTAACAAACA ATCCATTCCA TCCTCGTTTT
AATTAGTTGC TTACAAAGtt gagtcgataa tcatacagct ctttgctaat attgggtgaa gattcaccaa taaaatttag
tagttgtggg attttacctt gtctggtttt tattagtttg ctttcacttt tggttttatt actttagcta catactgaat
gtgtgtgagt ttgcttttat acgatccttg taataattag ctgtagctcT TAAGCAAGGC TACATACTGA ATGTTTTATT
CTATTATCTT AAAAAAAATT AGTTGCTTGC AAAATGTTTT ATCTCAACTC TGTTGATCga tatggttggc cagtgcctga
agccgttgcg gccggcgctg ttcggggaag gcgaggagca gaagaaatcc atggaggaga cacgggaggg cctgacggtg
gcggaggcgg agctcagggg caagcggttc tccggaggca gctccatcgg cctcgccgac atcgccggcg gtggcgtgct
ggctcactgg gtcggcgtgc tccaagaggt cgccggagtg agcgtcctga gcgacggcga cggcgagtac cctgctctgc
gccggtgggc gaaggattac gtcgctaatg aatccgtgat ggagtgcttg ccggatagag atcggctcct ctcctacttc
accgggatca agcagaagtg cgtttcggtg gccaagtcta cgctgccaaa Gtactccctt cttccctaaa tatttacgca
gttgactttt ttaaatatat ttaactgttc gtcttattta aaaacttttg tgaaatatgt aatattatat atatacataa
aagtatattt aacaataaat taaatgatag aaaaagaatt aataattact taaatttttc aaataagacg aacggttaaa
tatttttaaa aaagtcaacg gcgtcaaata ttttgggatg gagggagtaG TTACTAGTGA TGAACGAATA AACTAATAGC
GGCGTGCACC TTGTGGCTAA TTGAGTTTCG TCTTTCTTGT CGACGTGTTA TTGTGTTGTC TCTGTTTGTC ACATGCACGT
TTGACCGTAT GTACGATTAA TCTTTCGTCA TGATACAGTA CGAGCAAGG