Os01t0949800-01

Locus

Os01g0949800

Description

Similar to Glutathione S-transferase GST 28 (EC 2.5.1.18) (Fragment).

Transcript Evidence

AK064612 (DDBJ, Best hit)

Protein Evidence

Q10HA8 (UniProt)

CGSNL Gene Symbol

GSTU36

CGSNL Gene Name

TAU GLUTATHIONE S-TRANSFERASE 36

CGSNL Gene Symbol Synonym(s)

OsGSTU36

CGSNL Gene Name Synonym(s)

_

Literature (PMID)

Manual Curation

Note

GO

Molecular Function: protein binding (GO:0005515)

InterPro

Glutathione S-transferase, N-terminal (IPR004045)

Glutathione S-transferase, C-terminal (IPR004046)

Glutathione S-transferase, C-terminal-like (IPR010987)

Thioredoxin-like fold (IPR012336)

Glutathione S-transferase/chloride channel, C-terminal (IPR017933)

KEGG

Os01t0949800-01 (EC:2.5.1.18)

KOME

002-113-B12 (Online Clone Ordering)

RiceXPro Database

AK064612

Oryzabase

9553

Plant Gene Family Database (PGFD)

Os01t0949800-01

Transcript

857 bp

>Os01t0949800-01 Similar to Glutathione S-transferase GST 28 (EC 2.5.1.18) (Fragment).
ATATGagcagaaagccaagaacacacttggaagcaaacaaccaaatatggctgatccagt
taagctcatcggcgcatttggcagcccgttcgtgcaccgagccgaggttgccctgcggct
caagggagtggcttacgagttcatccacgaggaccttgacaacaagagcgacctgcttct
cgccaaaaaccccatccacaagaaggtccccgtgctcctccatggcgaccgtgccatctg
cgagtcgctcgtcatcgtcgagtacgcggacgaggtgttcgacggccgtcccatcctacc
caccgacccctacgaccgcgccatggcccgtttctgggctcacttcatcgaACACAagtg
ctcgaggtcatcgtggctggcattgtggttggacggcgaggagcaggaggggcttctgaa
ggagacgaaggagaacctggcgcttctggaggcgcagctccatgggaagaggttctttgc
cggtgactcggtcggctacctcgacattgttgccagtggactggctcactggatcagcgt
ggttgaggaggtgaccggagtgagcttgatgggcggcgccgacgaggatgacgagtatcc
tgctctacgccgttgggccaaggagtacaccacggatgagaccgtgatgcagtgcctgcc
gagcagagagcacctcgctgccttcttcgctgcgaagaaggacaagctgaagatggtggc
taaggcgatgctgcatcagtgattgtgagtgttgtgGGGGCCGACAGTGGGAGTGTATGT
CTCAGGTGATGGTGCTTCTTAAATAAAATCGAATCAGAACATAATTAAACGATTATAAAG
CCGAAAGTTCTACACGT

CDS

696 bp

>Os01t0949800-01 Similar to Glutathione S-transferase GST 28 (EC 2.5.1.18) (Fragment).
atggctgatccagttaagctcatcggcgcatttggcagcccgttcgtgcaccgagccgag
gttgccctgcggctcaagggagtggcttacgagttcatccacgaggaccttgacaacaag
agcgacctgcttctcgccaaaaaccccatccacaagaaggtccccgtgctcctccatggc
gaccgtgccatctgcgagtcgctcgtcatcgtcgagtacgcggacgaggtgttcgacggc
cgtcccatcctacccaccgacccctacgaccgcgccatggcccgtttctgggctcacttc
atcgaACACAagtgctcgaggtcatcgtggctggcattgtggttggacggcgaggagcag
gaggggcttctgaaggagacgaaggagaacctggcgcttctggaggcgcagctccatggg
aagaggttctttgccggtgactcggtcggctacctcgacattgttgccagtggactggct
cactggatcagcgtggttgaggaggtgaccggagtgagcttgatgggcggcgccgacgag
gatgacgagtatcctgctctacgccgttgggccaaggagtacaccacggatgagaccgtg
atgcagtgcctgccgagcagagagcacctcgctgccttcttcgctgcgaagaaggacaag
ctgaagatggtggctaaggcgatgctgcatcagtga

Protein

232 aa

>Os01t0949800-01 Similar to Glutathione S-transferase GST 28 (EC 2.5.1.18) (Fragment).
MADPVKLIGAFGSPFVHRAEVALRLKGVAYEFIHEDLDNKSDLLLAKNPIHKKVPVLLHG
DRAICESLVIVEYADEVFDGRPILPTDPYDRAMARFWAHFIEHKCSRSSWLALWLDGEEQ
EGLLKETKENLALLEAQLHGKRFFAGDSVGYLDIVASGLAHWISVVEEVTGVSLMGGADE
DDEYPALRRWAKEYTTDETVMQCLPSREHLAAFFAAKKDKLKMVAKAMLHQ*

5'UTR

chr01:41844012..41844057 (+ strand) : 46 bp

CDS

chr01:41844058..41844367 (+ strand) : 310 bp

chr01:41844805..41845190 (+ strand) : 386 bp

3'UTR

chr01:41845191..41845305 (+ strand) : 115 bp

FASTA

>Os01t0949800-01 class=Sequence position=chr01:41844012..41845305 (+ strand)
ATATGagcag aaagccaaga acacacttgg aagcaaacaa ccaaatatgg ctgatccagt taagctcatc ggcgcatttg
gcagcccgtt cgtgcaccga gccgaggttg ccctgcggct caagggagtg gcttacgagt tcatccacga ggaccttgac
aacaagagcg acctgcttct cgccaaaaac cccatccaca agaaggtccc cgtgctcctc catggcgacc gtgccatctg
cgagtcgctc gtcatcgtcg agtacgcgga cgaggtgttc gacggccgtc ccatcctacc caccgacccc tacgaccgcg
ccatggcccg tttctgggct cacttcatcg aACACAAGGC AATATATATA ATCGTTGTCG ATAACCTCTG AAATTTCACA
AGGTTTTTCC GCTTACTGAg gggctgttta gttcctcaaa aacttttccc aaaaacatca tattgaatat ttgaacacat
gtatagagca ttaattaaat atatataaaa aaaattaatt gcacagtttg catgtaaatc gcgagacgag tcttttaagc
ctaattagta catgattagc cataagtgtt atagtaaact acatgtgcta atgacagatt aattaggctc aaaagattcg
tctcacggtt ttcaggcaag ttatgaaatt agttttttca ttcgtgtcca aaaactcctt ccgacatccg gtcaaacgtc
cgatttgaca cccaaaaatt ttcatttcac aaactaaaca aaccctgaac agtacaaatt catgaacatg tacagtgctc
gaggtcatcg tggctggcat tgtggttgga cggcgaggag caggaggggc ttctgaagga gacgaaggag aacctggcgc
ttctggaggc gcagctccat gggaagaggt tctttgccgg tgactcggtc ggctacctcg acattgttgc cagtggactg
gctcactgga tcagcgtggt tgaggaggtg accggagtga gcttgatggg cggcgccgac gaggatgacg agtatcctgc
tctacgccgt tgggccaagg agtacaccac ggatgagacc gtgatgcagt gcctgccgag cagagagcac ctcgctgcct
tcttcgctgc gaagaaggac aagctgaaga tggtggctaa ggcgatgctg catcagtgat tgtgagtgtt gtgGGGGCCG
ACAGTGGGAG TGTATGTCTC AGGTGATGGT GCTTCTTAAA TAAAATCGAA TCAGAACATA ATTAAACGAT TATAAAGCCG
AAAGTTCTAC ACGT