Os02t0152400-01

Locus

Os02g0152400

Description

Rubisco small subunit 1, Reguration of Rubisco catalytic activity

Transcript Evidence

AK059909

Protein Evidence

Q67IU5

CGSNL Gene Symbol

CGSNL Gene Name

CGSNL Gene Symbol Synonym(s)

RbcS1, OsRBCS1, OsRbcS1

CGSNL Gene Name Synonym(s)

RuBisCO small subunit 1, Ribulose-1,5-Bisphosphate Carboxylase/Oxygenase Small Subunit 1

Literature (PMID)

24254313

Manual Curation

January 24, 2014

Note

InterPro

Ribulose bisphosphate carboxylase, small chain (IPR024681)

Ribulose bisphosphate carboxylase small chain, domain (IPR000894)

KEGG

Os02t0152400-01 (EC:4.1.1.39)

KOME

006-209-C06 (Online Clone Ordering)

RiceXPro Database

AK059909

Oryzabase

12042

Plant Gene Family Database (PGFD)

Os02t0152400-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os02t0152400-01

Transcript

999 bp

>Os02t0152400-01 Rubisco small subunit 1, Reguration of Rubisco catalytic activity
ATCCCAAGTGCACCGGTGCCACCTTCTCCCAGCGCCACCACACTCTCCATCTCTTGTCAC
CTTGCTCTACTCTCCCCTTCTTAACCTCTTCACGCCACCGCCGGCCACCACCACCACTCT
CTACTCCGGCGACATCATGTTCATCAACACGGCCAGCTTCGTCGCCGGCGCCGTCGTCGC
TTCGCCGGAGCAGCCGGCCAAGCTTGTCCGGGATCAGAGGAGGGTGGTGCCTGGCTCCTG
CAGGGCAAGAAGAGGTGCAGCATCCAATGGCTTCAGAACTTACTGCATGCAGACATGGAA
CCCTTTCACCAACAGGAGGTACGAGGCGATGTCTTACCTGCCTCCCCTGAGCGCGAAGTC
CATCTCCAAGGAGATCGAGTTCATCATGTCCAAAGGATGGGTCCCTTGCCTCGAGTTTGA
CAAGGAGGGGGAGATCCACCGGAGCAACAGCCGGATGCCGGGGTACTACGACGGGAGGTA
CTGGACGCTGTGGAAGCTGCCGATGTTCGGATGCTCTGACGCGGCGGCGGTGCTCCGGGA
GGTGGAGGAATGCCGGAGGGAGTACCCGGACGCCTTCATCCGCCTCATCGCCTTCGACAG
CAGCCGCCAGTGCCAGTGCATGTCCTTCGTCGTCCACAAGCCGCCGTCGGCCGCCGCTTC
TCCGGCCACGGTCGCCGGAGCTGAATGAACCAAGGTGTTCAGTTCATGTTCATCCTCGCT
TCGATGATCATCAGTCACAGCATCCATCCAACCAGTTTCCTTCCTCTTCTTCGGTCTCTT
GCTCACTTGCATGTGCTGTACCACTTCTTTCAGTTCAACTTCAACCTCATCTTTGATGAC
TACTGTGATGTACTAATGTTGCTTCGAGTATAATGAGCACAATGATGATCATAGCATCCA
TCCAACCAGTTATCTTCCTCTTCTTCAGCATCATCTTCATTTGCAGGTGTTCTATGTACC
TCTTCTTCCAGTTCAACTTCAACATCTAATCTTTGAGCG

CDS

552 bp

>Os02t0152400-01 Rubisco small subunit 1, Reguration of Rubisco catalytic activity
ATGTTCATCAACACGGCCAGCTTCGTCGCCGGCGCCGTCGTCGCTTCGCCGGAGCAGCCG
GCCAAGCTTGTCCGGGATCAGAGGAGGGTGGTGCCTGGCTCCTGCAGGGCAAGAAGAGGT
GCAGCATCCAATGGCTTCAGAACTTACTGCATGCAGACATGGAACCCTTTCACCAACAGG
AGGTACGAGGCGATGTCTTACCTGCCTCCCCTGAGCGCGAAGTCCATCTCCAAGGAGATC
GAGTTCATCATGTCCAAAGGATGGGTCCCTTGCCTCGAGTTTGACAAGGAGGGGGAGATC
CACCGGAGCAACAGCCGGATGCCGGGGTACTACGACGGGAGGTACTGGACGCTGTGGAAG
CTGCCGATGTTCGGATGCTCTGACGCGGCGGCGGTGCTCCGGGAGGTGGAGGAATGCCGG
AGGGAGTACCCGGACGCCTTCATCCGCCTCATCGCCTTCGACAGCAGCCGCCAGTGCCAG
TGCATGTCCTTCGTCGTCCACAAGCCGCCGTCGGCCGCCGCTTCTCCGGCCACGGTCGCC
GGAGCTGAATGA

Protein

184 aa

>Os02t0152400-01 Rubisco small subunit 1, Reguration of Rubisco catalytic activity
MFINTASFVAGAVVASPEQPAKLVRDQRRVVPGSCRARRGAASNGFRTYCMQTWNPFTNR
RYEAMSYLPPLSAKSISKEIEFIMSKGWVPCLEFDKEGEIHRSNSRMPGYYDGRYWTLWK
LPMFGCSDAAAVLREVEECRREYPDAFIRLIAFDSSRQCQCMSFVVHKPPSAAASPATVA
GAE*

5'UTR

chr02:2874951..2875086 (+ strand) : 136 bp

CDS

chr02:2875087..2875242 (+ strand) : 156 bp

chr02:2875403..2875534 (+ strand) : 132 bp

chr02:2875680..2875943 (+ strand) : 264 bp

3'UTR

chr02:2875944..2876254 (+ strand) : 311 bp

FASTA

>Os02t0152400-01 class=Sequence position=chr02:2874951..2876254 (+ strand)
ATCCCAAGTG CACCGGTGCC ACCTTCTCCC AGCGCCACCA CACTCTCCAT CTCTTGTCAC CTTGCTCTAC TCTCCCCTTC
TTAACCTCTT CACGCCACCG CCGGCCACCA CCACCACTCT CTACTCCGGC GACATCATGT TCATCAACAC GGCCAGCTTC
GTCGCCGGCG CCGTCGTCGC TTCGCCGGAG CAGCCGGCCA AGCTTGTCCG GGATCAGAGG AGGGTGGTGC CTGGCTCCTG
CAGGGCAAGA AGAGGTGCAG CATCCAATGG CTTCAGAACT TACTGCATGC AGGTGAGCAA TTCAGCAAAC ATGAAACTTT
CTCTGCATAT CTATATGTTA CTTTTGTTTT GAGGAGTCGA AAAAGATCAG ATCAAAGTGT TTTCTTTTCG GCATGAAATA
CTTGCAAAAT CAGCTTACAG TAAATTCAGC GAGTGATTTA ATTTTGTTGT AGACATGGAA CCCTTTCACC AACAGGAGGT
ACGAGGCGAT GTCTTACCTG CCTCCCCTGA GCGCGAAGTC CATCTCCAAG GAGATCGAGT TCATCATGTC CAAAGGATGG
GTCCCTTGCC TCGAGTTTGA CAAGGTACAA ACTAAGCATC AAACTTGTCC TAACTCTTTT TGTAATTACA CTAATTTTCT
CCATGATGAA TTTATCCATC AGTTAGTATT TACCCAAAAG AAAAATGTAT TGTTATAAGT TTGTACTATG AATGGATGAT
ATGGTGTAGG AGGGGGAGAT CCACCGGAGC AACAGCCGGA TGCCGGGGTA CTACGACGGG AGGTACTGGA CGCTGTGGAA
GCTGCCGATG TTCGGATGCT CTGACGCGGC GGCGGTGCTC CGGGAGGTGG AGGAATGCCG GAGGGAGTAC CCGGACGCCT
TCATCCGCCT CATCGCCTTC GACAGCAGCC GCCAGTGCCA GTGCATGTCC TTCGTCGTCC ACAAGCCGCC GTCGGCCGCC
GCTTCTCCGG CCACGGTCGC CGGAGCTGAA TGAACCAAGG TGTTCAGTTC ATGTTCATCC TCGCTTCGAT GATCATCAGT
CACAGCATCC ATCCAACCAG TTTCCTTCCT CTTCTTCGGT CTCTTGCTCA CTTGCATGTG CTGTACCACT TCTTTCAGTT
CAACTTCAAC CTCATCTTTG ATGACTACTG TGATGTACTA ATGTTGCTTC GAGTATAATG AGCACAATGA TGATCATAGC
ATCCATCCAA CCAGTTATCT TCCTCTTCTT CAGCATCATC TTCATTTGCA GGTGTTCTAT GTACCTCTTC TTCCAGTTCA
ACTTCAACAT CTAATCTTTG AGCG