Os02t0244700-01

Locus

Os02g0244700

Description

Similar to Phosphoenolpyruvate carboxylase 1 (EC 4.1.1.31) (PEPCase 1) (CP21).

Transcript Evidence

AK065425 (DDBJ, Best hit)

Protein Evidence

Q9FYX8 (UniProt)

CGSNL Gene Symbol

_

CGSNL Gene Name

_

CGSNL Gene Symbol Synonym(s)

PEPC-1

CGSNL Gene Name Synonym(s)

PEP carboxylase 1, Phosphoenolpyruvate carboxylase 1

Literature (PMID)

Manual Curation

Note

GO

Biological Process: tricarboxylic acid cycle (GO:0006099)

Biological Process: carbon fixation (GO:0015977)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: phosphoenolpyruvate carboxylase activity (GO:0008964)

InterPro

Pyruvate/Phosphoenolpyruvate kinase (IPR015813)

Phosphoenolpyruvate carboxylase, active site (IPR018129)

Phosphoenolpyruvate carboxylase (IPR021135)

KEGG

Os02t0244700-01 (EC:4.1.1.31)

KOME

J013011N21 (Online Clone Ordering)

RiceXPro Database

AK065425

Oryzabase

11419

Plant Gene Family Database (PGFD)

Os02t0244700-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os02t0244700-01

Transcript

3808 bp

>Os02t0244700-01 Similar to Phosphoenolpyruvate carboxylase 1 (EC 4.1.1.31) (PEPCase 1) (CP21).
ACCCACACACCCACACTCTCTACCCCCAAACTTGCCCTCCAATCTATCTCCGCCGCCGCC
GCCGCCTCCGCCGCGAGAGGGCGTCGCCGAGCTGCGCGGGAGGCTCGCCTCCCGCAGCAT
CTGGCCGGATTCGTCGTAGTCGAGGCAGCTGTAAGCGAGAGAGAGGGAGATGGCCGCGGC
CGCCGGGAAGGCGGCGATGGAGCGGCACCAGTCGATCGACGCGCAGCTGCGGCTGCTCGC
GCCGGGGAAGGTATCCGAGGACGACAAGCTCGTCGAGTACGACGCCCTCCTCGTCGACCG
CTTCCTCGACATCCTCCAGGACCTGCACGGCCCTCACCTCCGCGAATTCGTGCAGGAGTG
CTACGAGCTGTCGGCGGAGTACGAGAACGACAGGGACGAGGCGCGGCTCGACGAGCTGGG
GAGGAAGCTCACCAGCCTGCCGCCGGGGGACTCCATCGTCGTCTCCAGCTCCTTCTCGCA
CATGCTCAACCTCGCCAACCTCGCCGAGGAGGTGCAGATCGCGCACCGCCGCCGGATCAA
GCTCAAGCGCGGGGACTTCGCCGACGAGGCCTCCGCGCCCACCGAGTCCGACATCGAGGA
GACGCTCAAGCGCCTCGTCACCCAGCTCGGCAAGTCGAGGGAGGAGGTGTTCGATGCGCT
CAAGAACCAGACCGTTGACCTCGTGTTCACCGCGCATCCAACGCAGTCCGTCAGGAGGTC
CCTGCTCCAGAAGCACGGGAGGATCCGGAATTGCCTGAGGCAGTTATATGCGAAAGACAT
CACTGCTGATGACAAGCAGGAGCTTGATGAGGCCCTGCAGAGGGAGATTCAAGCAGCTTT
CAGAACTGATGAAATCCGCAGGACTCCTCCCACTCCTCAGGATGAAATGCGCGCCGGGAT
GAGTTATTTTCATGAAACTATATGGAAGGGTGTACCAAAGTTCTTGCGCCGCATTGATAC
TGCTCTGAAAAATATTGGGATTAATGAGCGTCTTCCTTACAATGCTCCTCTCATCCAGTT
CTCATCCTGGATGGGTGGTGACCGTGATGGAAACCCAAGAGTTACACCAGAGGTTACAAG
AGATGTATGCTTGTTGGCAAGAATGATGGCTGCTAACCTGTACTTCTCTCAGATAGAAGA
TCTGATGTTTGAGCTCTCTATGTGGCGCTGCAGTGATGAACTTCGAATTCGTGCAGATGA
TTTGCATTGCTCCTCCAGAAAAGCTGCAAAGCACTATATAGAATTCTGGAAGCAAATTCC
TCCAAATGAGCCTTATCGTGTCATACTTGGTGGTGTCAGGGATAAATTGTACTATACGCG
TGAACGTACTCGCCATCTATTGACAACTGGAGTTTCTGAAATTCCAGAGGAGGCAACGTT
TACTAATGTTGAAGAGTTTCTGGAGCCGCTTGAGCTGTGCTACAGATCATTATGTGCTTG
TGGTGACAAACCTATAGCTGATGGAAGCCTTCTTGATTTCTTGCGTCAAGTATCAACTTT
TGGGCTGGCTCTTGTAAAACTTGACATAAGGCAGGAGTCTGATCGACACACTGATGTCCT
TGATGCCATAACTACATATCTTGGGATTGGATCTTACGCTGAATGGTCTGAGGAGAAACG
CCAGGATTGGCTTTTGTCCGAACTAAGGGGCAAACGTCCTTTGTTTGGTCCTGATCTTCC
TCAGACTGAAGAAATTGCTGATGTTTTAGGAACATTTCACGTCCTTGCTGAGCTCCCGGC
AGATTGTTTTGGTGCTTACATCATCTCAATGGCAACTGCACCATCTGATGTGCTTGCTGT
GGAGCTTCTACAGCGGGAGTGCCATATAAAACAGCCTCTGCGAGTTGTTCCCCTATTTGA
GAAACTTGCAGATCTTGAAGCAGCTCCAGCAGCGGTGGCACGACTATTTTCAATAGACTG
GTACATGAATAGGATTAATGGCAAGCAGGAGGTCATGATTGGATACTCAGACTCTGGCAA
GGATGCTGGTCGTCTTTCTGCAGCATGGCAAATGTACAAAGCACAAGAGGAGCTTGTCAA
GGTGGCAAAGCATTATGGTGTAAAGTTGACAATGTTCCATGGAAGAGGTGGAACAGTTGG
CAGAGGAGGTGGTCCCAGTCATCTTGCCATATTATCTCAACCACCAGACACGATACATGG
ATCACTTCGTGTAACAGTACAGGGCGAGGTTATTGAACACTCGTTTGGAGAGGAACACTT
GTGCTTTAGAACTCTGCAGCGCTTTACTGCAGCTACTCTTGAGCATGGAATGCATCCTCC
AATTTCCCCCAAACCAGAATGGCGTGCTCTAATGGATGAGATGGCTGTTGTGGCAACAAA
GGAATATCGATCAATCGTCTTCAAGGAGCCACGGTTTGTTGAATACTTCCGATCGGCAAC
ACCTGAGACAGAATATGGCAGGATGAACATTGGTAGCCGACCATCAAAGAGAAAGCCTAG
TGGTGGCATTGAATCGCTCCGTGCAATTCCTTGGATTTTTGCTTGGACACAAACTAGGTT
TCATCTTCCTGTATGGCTTGGATTTGGTGGAGCGTTCAAACATATAATGCAGAAGGATAT
CAGGAACATCCATACACTGAAAGAAATGTACAATGAGTGGCCATTCTTCAGGGTCACCTT
GGACTTGCTTGAGATGGTTTTCGCCAAGGGAGATCCAGGAATTGCTGCTTTATATGACAA
ATTGCTTGTGGCAGGTGATCTGCAATCCTTTGGAGAGCAGCTGAGAAACAACTTTGAAGA
GACAAAACAGCTACTCCTTCAGGTTGCCGGTCACAAGGATATTCTGGAAGGGGATCCTTA
CCTGAAGCAGCGTCTGCGGCTGCGTGAGTCGTACATCACTACCTTGAACGTTTGCCAAGC
CTACACCCTGAAGCGGATAAGGGACCCTAGCTTCGAGGTGATGTCGCAGCCGGCCTTGTC
GAAGGAGTTCGTCGACAGCAACCAGCCTGCCGAGCTGGTCCAACTGAACGCTGCGAGCGA
GTACGCACCTGGCCTGGAGGACACCCTCATCCTGACGATGAAGGGCATTGCTGCCGGCAT
GCAGAACACAGGCTAGATTGTCCACAAGAATGCTTCCAGCAGGTGCAATCAATCAATCAT
CAATAACTCCTTCCATGATGAGATGGTGAATATGTTTAACTACCCGATCCAAAATAAAAT
ATGGACCAATCATTCTACGAAGCTTGATTCTGAACGCTTCGAATTTGCATCAGTGGTGAC
AGCGGCTGTGTTTGCATCTTTAAACGACAGACTAAAAGCATTGTGCACCGCAAGATGCAG
ACTTGACATGTGCTTATAGCAGAAGTATTACATGGAGCACATCTCAGGGTCAGGTATATT
GCAATCTCAAAAATCAGGAGATACACAATCAGATGGATATGAAATGAGAAGCAAAATTGT
GTCTGAAGAAATGAGAAGCAAGAAGACAGTTAAAGGGTCTGATGGGTTACAGTCTGAAAA
ATCAGGGGATATGCAATCGGAGAGATATGAAAGTGACAAAATTTTGTCCAGAGAAATAAG
AAGCAAGAAAACATTGAAAGGTCAGTTATCATGCTCACCTAGCATTATGCACCATAAAAT
GATCTTGGCAGACAATATAATCTAGCATAAAATTATATACAACAAATTAGAGATTGTAGC
GTTGATAAATTTTCAAGGACTATATATCTATAGTTAGTTACAGTGAGAAATAACAAAAGT
TACATATGTAACTACAATACATATAGACTGTAACTGGGCTAAAACTGCAAGCATGCTTGA
ATTTCTTCAAAAAATAAAGAATTTCTTC

CDS

2907 bp

>Os02t0244700-01 Similar to Phosphoenolpyruvate carboxylase 1 (EC 4.1.1.31) (PEPCase 1) (CP21).
ATGGCCGCGGCCGCCGGGAAGGCGGCGATGGAGCGGCACCAGTCGATCGACGCGCAGCTG
CGGCTGCTCGCGCCGGGGAAGGTATCCGAGGACGACAAGCTCGTCGAGTACGACGCCCTC
CTCGTCGACCGCTTCCTCGACATCCTCCAGGACCTGCACGGCCCTCACCTCCGCGAATTC
GTGCAGGAGTGCTACGAGCTGTCGGCGGAGTACGAGAACGACAGGGACGAGGCGCGGCTC
GACGAGCTGGGGAGGAAGCTCACCAGCCTGCCGCCGGGGGACTCCATCGTCGTCTCCAGC
TCCTTCTCGCACATGCTCAACCTCGCCAACCTCGCCGAGGAGGTGCAGATCGCGCACCGC
CGCCGGATCAAGCTCAAGCGCGGGGACTTCGCCGACGAGGCCTCCGCGCCCACCGAGTCC
GACATCGAGGAGACGCTCAAGCGCCTCGTCACCCAGCTCGGCAAGTCGAGGGAGGAGGTG
TTCGATGCGCTCAAGAACCAGACCGTTGACCTCGTGTTCACCGCGCATCCAACGCAGTCC
GTCAGGAGGTCCCTGCTCCAGAAGCACGGGAGGATCCGGAATTGCCTGAGGCAGTTATAT
GCGAAAGACATCACTGCTGATGACAAGCAGGAGCTTGATGAGGCCCTGCAGAGGGAGATT
CAAGCAGCTTTCAGAACTGATGAAATCCGCAGGACTCCTCCCACTCCTCAGGATGAAATG
CGCGCCGGGATGAGTTATTTTCATGAAACTATATGGAAGGGTGTACCAAAGTTCTTGCGC
CGCATTGATACTGCTCTGAAAAATATTGGGATTAATGAGCGTCTTCCTTACAATGCTCCT
CTCATCCAGTTCTCATCCTGGATGGGTGGTGACCGTGATGGAAACCCAAGAGTTACACCA
GAGGTTACAAGAGATGTATGCTTGTTGGCAAGAATGATGGCTGCTAACCTGTACTTCTCT
CAGATAGAAGATCTGATGTTTGAGCTCTCTATGTGGCGCTGCAGTGATGAACTTCGAATT
CGTGCAGATGATTTGCATTGCTCCTCCAGAAAAGCTGCAAAGCACTATATAGAATTCTGG
AAGCAAATTCCTCCAAATGAGCCTTATCGTGTCATACTTGGTGGTGTCAGGGATAAATTG
TACTATACGCGTGAACGTACTCGCCATCTATTGACAACTGGAGTTTCTGAAATTCCAGAG
GAGGCAACGTTTACTAATGTTGAAGAGTTTCTGGAGCCGCTTGAGCTGTGCTACAGATCA
TTATGTGCTTGTGGTGACAAACCTATAGCTGATGGAAGCCTTCTTGATTTCTTGCGTCAA
GTATCAACTTTTGGGCTGGCTCTTGTAAAACTTGACATAAGGCAGGAGTCTGATCGACAC
ACTGATGTCCTTGATGCCATAACTACATATCTTGGGATTGGATCTTACGCTGAATGGTCT
GAGGAGAAACGCCAGGATTGGCTTTTGTCCGAACTAAGGGGCAAACGTCCTTTGTTTGGT
CCTGATCTTCCTCAGACTGAAGAAATTGCTGATGTTTTAGGAACATTTCACGTCCTTGCT
GAGCTCCCGGCAGATTGTTTTGGTGCTTACATCATCTCAATGGCAACTGCACCATCTGAT
GTGCTTGCTGTGGAGCTTCTACAGCGGGAGTGCCATATAAAACAGCCTCTGCGAGTTGTT
CCCCTATTTGAGAAACTTGCAGATCTTGAAGCAGCTCCAGCAGCGGTGGCACGACTATTT
TCAATAGACTGGTACATGAATAGGATTAATGGCAAGCAGGAGGTCATGATTGGATACTCA
GACTCTGGCAAGGATGCTGGTCGTCTTTCTGCAGCATGGCAAATGTACAAAGCACAAGAG
GAGCTTGTCAAGGTGGCAAAGCATTATGGTGTAAAGTTGACAATGTTCCATGGAAGAGGT
GGAACAGTTGGCAGAGGAGGTGGTCCCAGTCATCTTGCCATATTATCTCAACCACCAGAC
ACGATACATGGATCACTTCGTGTAACAGTACAGGGCGAGGTTATTGAACACTCGTTTGGA
GAGGAACACTTGTGCTTTAGAACTCTGCAGCGCTTTACTGCAGCTACTCTTGAGCATGGA
ATGCATCCTCCAATTTCCCCCAAACCAGAATGGCGTGCTCTAATGGATGAGATGGCTGTT
GTGGCAACAAAGGAATATCGATCAATCGTCTTCAAGGAGCCACGGTTTGTTGAATACTTC
CGATCGGCAACACCTGAGACAGAATATGGCAGGATGAACATTGGTAGCCGACCATCAAAG
AGAAAGCCTAGTGGTGGCATTGAATCGCTCCGTGCAATTCCTTGGATTTTTGCTTGGACA
CAAACTAGGTTTCATCTTCCTGTATGGCTTGGATTTGGTGGAGCGTTCAAACATATAATG
CAGAAGGATATCAGGAACATCCATACACTGAAAGAAATGTACAATGAGTGGCCATTCTTC
AGGGTCACCTTGGACTTGCTTGAGATGGTTTTCGCCAAGGGAGATCCAGGAATTGCTGCT
TTATATGACAAATTGCTTGTGGCAGGTGATCTGCAATCCTTTGGAGAGCAGCTGAGAAAC
AACTTTGAAGAGACAAAACAGCTACTCCTTCAGGTTGCCGGTCACAAGGATATTCTGGAA
GGGGATCCTTACCTGAAGCAGCGTCTGCGGCTGCGTGAGTCGTACATCACTACCTTGAAC
GTTTGCCAAGCCTACACCCTGAAGCGGATAAGGGACCCTAGCTTCGAGGTGATGTCGCAG
CCGGCCTTGTCGAAGGAGTTCGTCGACAGCAACCAGCCTGCCGAGCTGGTCCAACTGAAC
GCTGCGAGCGAGTACGCACCTGGCCTGGAGGACACCCTCATCCTGACGATGAAGGGCATT
GCTGCCGGCATGCAGAACACAGGCTAG

Protein

969 aa

>Os02t0244700-01 Similar to Phosphoenolpyruvate carboxylase 1 (EC 4.1.1.31) (PEPCase 1) (CP21).
MAAAAGKAAMERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREF
VQECYELSAEYENDRDEARLDELGRKLTSLPPGDSIVVSSSFSHMLNLANLAEEVQIAHR
RRIKLKRGDFADEASAPTESDIEETLKRLVTQLGKSREEVFDALKNQTVDLVFTAHPTQS
VRRSLLQKHGRIRNCLRQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTPPTPQDEM
RAGMSYFHETIWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTP
EVTRDVCLLARMMAANLYFSQIEDLMFELSMWRCSDELRIRADDLHCSSRKAAKHYIEFW
KQIPPNEPYRVILGGVRDKLYYTRERTRHLLTTGVSEIPEEATFTNVEEFLEPLELCYRS
LCACGDKPIADGSLLDFLRQVSTFGLALVKLDIRQESDRHTDVLDAITTYLGIGSYAEWS
EEKRQDWLLSELRGKRPLFGPDLPQTEEIADVLGTFHVLAELPADCFGAYIISMATAPSD
VLAVELLQRECHIKQPLRVVPLFEKLADLEAAPAAVARLFSIDWYMNRINGKQEVMIGYS
DSGKDAGRLSAAWQMYKAQEELVKVAKHYGVKLTMFHGRGGTVGRGGGPSHLAILSQPPD
TIHGSLRVTVQGEVIEHSFGEEHLCFRTLQRFTAATLEHGMHPPISPKPEWRALMDEMAV
VATKEYRSIVFKEPRFVEYFRSATPETEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWT
QTRFHLPVWLGFGGAFKHIMQKDIRNIHTLKEMYNEWPFFRVTLDLLEMVFAKGDPGIAA
LYDKLLVAGDLQSFGEQLRNNFEETKQLLLQVAGHKDILEGDPYLKQRLRLRESYITTLN
VCQAYTLKRIRDPSFEVMSQPALSKEFVDSNQPAELVQLNAASEYAPGLEDTLILTMKGI
AAGMQNTG*

5'UTR

chr02:8183999..8184167 (- strand) : 169 bp

CDS

chr02:8183819..8183998 (- strand) : 180 bp

chr02:8183326..8183717 (- strand) : 392 bp

chr02:8183152..8183236 (- strand) : 85 bp

chr02:8182228..8182450 (- strand) : 223 bp

chr02:8181802..8181905 (- strand) : 104 bp

chr02:8181626..8181713 (- strand) : 88 bp

chr02:8180700..8180854 (- strand) : 155 bp

chr02:8179618..8180616 (- strand) : 999 bp

chr02:8178722..8179108 (- strand) : 387 bp

chr02:8178053..8178346 (- strand) : 294 bp

3'UTR

chr02:8177967..8178052 (- strand) : 86 bp

chr02:8177672..8177856 (- strand) : 185 bp

chr02:8173877..8173984 (- strand) : 108 bp

chr02:8172421..8172773 (- strand) : 353 bp

FASTA

>Os02t0244700-01 class=Sequence position=chr02:8172421..8184167 (- strand)
ACCCACACAC CCACACTCTC TACCCCCAAA CTTGCCCTCC AATCTATCTC CGCCGCCGCC GCCGCCTCCG CCGCGAGAGG
GCGTCGCCGA GCTGCGCGGG AGGCTCGCCT CCCGCAGCAT CTGGCCGGAT TCGTCGTAGT CGAGGCAGCT GTAAGCGAGA
GAGAGGGAGA TGGCCGCGGC CGCCGGGAAG GCGGCGATGG AGCGGCACCA GTCGATCGAC GCGCAGCTGC GGCTGCTCGC
GCCGGGGAAG GTATCCGAGG ACGACAAGCT CGTCGAGTAC GACGCCCTCC TCGTCGACCG CTTCCTCGAC ATCCTCCAGG
ACCTGCACGG CCCTCACCTC CGCGAATTCG TAACTTACTT GCTTCCCAGA TCCTGTTGCT CGTGCCCGCC ACCTGTTCGA
TCGATTGCCC ACACGGTTGG TTGGCTTTGG TTTTGGTTCT CTTCTTGCAG GTGCAGGAGT GCTACGAGCT GTCGGCGGAG
TACGAGAACG ACAGGGACGA GGCGCGGCTC GACGAGCTGG GGAGGAAGCT CACCAGCCTG CCGCCGGGGG ACTCCATCGT
CGTCTCCAGC TCCTTCTCGC ACATGCTCAA CCTCGCCAAC CTCGCCGAGG AGGTGCAGAT CGCGCACCGC CGCCGGATCA
AGCTCAAGCG CGGGGACTTC GCCGACGAGG CCTCCGCGCC CACCGAGTCC GACATCGAGG AGACGCTCAA GCGCCTCGTC
ACCCAGCTCG GCAAGTCGAG GGAGGAGGTG TTCGATGCGC TCAAGAACCA GACCGTTGAC CTCGTGTTCA CCGCGCATCC
AACGCAGTCC GTCAGGAGGT CCCTGCTCCA GAAGCACGGG AGGTGCGTCG ATGAGCTGTC CCCTTCTCCG ATGCTCTCGG
TGCGTCGGGA AATGCTAAAT CTAATGCTCT TGATGTTGAC TCGCTGTGCA GGATCCGGAA TTGCCTGAGG CAGTTATATG
CGAAAGACAT CACTGCTGAT GACAAGCAGG AGCTTGATGA GGCCCTGCAG AGGGAGGTAA GTTGATTTTT TTTTTTGTCA
ATTTGTGGTT ACAATATTAT AAAGTCAATC ATAGCAAAAG TGTCCACCGC ACCATTTTGA TTATTTTACT GCTTATCAGC
TCAATGGCTT CTTTTTCTTG ATGACTTAAA TTATGGGTCT CTGGGCTTAA TGAGATTTGT ATACTCTCAG GCAGTAGCTT
AATTTAGAAT TAGGTCCATC CTAAAAGCTT AATTTAGTCG AAGTGGCAAA TCATGTTTGT GCCTCTTTTA TCTATGTGGT
GCCTGTCCTG CTCCATGATC TTGCCAAATA ATTTAGAAAT CTTATCTCTA TTGTCTGTAC ACCATTCTTT TATATTAGTT
TATTTGGACA AGGATTTTTT TTTTTACATT AGTTTAGTTG GAGACAAGGA AAAACATTGA ACACTAGGTG ATTATTTCCA
GATCCTCAAA AGGTGTTTAC CTATCACGTT CATAAATTAA TTGCTCTGTA CTTTTGGACT CTGTCTTGAC AGTTCTGAAG
TCCATCTCCA ATAGTTTTCT TTTGATACAC TTGAAATGAG AGCTCTTTTT GCTAGTTCTG ATTTCTGAGT GAAATTCATC
TTCAATCAGA GAAGTGCTAT GTGCATATTG CAAAGTTTAT GCAGAAATGT CGTGTTGGTT TCTACTACTC TGTTCTCATC
ATGCCTTTCT GATTGTGTGG TTTAACACGC TTCACAGATT CAAGCAGCTT TCAGAACTGA TGAAATCCGC AGGACTCCTC
CCACTCCTCA GGATGAAATG CGCGCCGGGA TGAGTTATTT TCATGAAACT ATATGGAAGG GTGTACCAAA GTTCTTGCGC
CGCATTGATA CTGCTCTGAA AAATATTGGG ATTAATGAGC GTCTTCCTTA CAATGCTCCT CTCATCCAGT TCTCATCCTG
GATGGGTGGT GACCGTGATG GTATCTTCTC CTATCCTAAC TTATACATCC ATTTTTGTTT AGAAAGGAAA ACAGAACTTG
GTTGAGATCT GTCACATGCT CACATGTGCT ATTGACAGAA AATTGGCTTG TTTGTCCTCT TAGTGACATC ATGGTATTAG
TTCTAGCAAT TGGTTATTTA TTCCCCTTCC ACACTTTTAA GTCAACAAAG ATTCCATTTT TTTCAAATAA TTGTATTATT
CACTTGTCTA AATATATTTT TTGAGATAAC TGCAGCCTTT TCTGCTCCCT GTAATCCTGT CTGTTAGAAG AAGTTGAACT
CTAAAACTGA CTTGTTTTCT AGGAAACCCA AGAGTTACAC CAGAGGTTAC AAGAGATGTA TGCTTGTTGG CAAGAATGAT
GGCTGCTAAC CTGTACTTCT CTCAGATAGA AGATCTGATG TTTGAGGTAC AGCAGAATTG CTTATTTTCA TTGTTCTTAA
AAAAGTACTG CAATACTGAT TTCTAAGTTT TAACAATGCA ATATGTTTTC CTAGCTCTCT ATGTGGCGCT GCAGTGATGA
ACTTCGAATT CGTGCAGATG ATTTGCATTG CTCCTCCAGA AAAGCTGCAA AGCACTATAT AGGTAACAAT ACCATAACTG
TGGTGATAAT GAATTTTGGG TCGGCCTGCG CATTTGTTGA TTTGTGTATC ATTTTATAGT CTGAAGGAAA AGCTGTACTT
TTGGTCTGCT TGCCCTTCTC TTTTTAGCAT ATGAAGTAAC CATTTTCAAG TTTTCAGATA GAGTTCTAAT ATGATGTTCA
TGCATTTTTT TAATGACCAA TATATCATTT TCTTAGCCTC TTTTTCTATC ATAGCCACCT CATATGCTTG TCTATAAGAT
CTGCCATCTT TCCTTTAATT TTTATCAGAG TTCACCTGTA CTGTAAAATC TTCAGGTGAT TTTACACTTG AAAATTGTGC
TTGCCAATTG CCAATTGTAA TGTGTATATT GTGGATACCA GTGTTGAATT ATTAGTCAGG TTAATTTGAA AAATGCATCT
GCTAGTTCAG AATCCACTAG AACTTTAATA TAAAGAAATT ATTTGTTTAG CCAAATATAA TTAGGCTGAC ATTGTTCTTC
CAGAGGCTGT GAAATCCCTA CTCAAAACAT TTATCAAGTT GACTACAGTG ATGGACTAAA ATGGACTGGA CGTTTTTATG
TCTAATATGG ATGCATCAAC TCCCGGCATA ACTACATTGA TTAACTACAT TTCATTTTTC CTCGGTTTGT TACTCATTTA
GCTGATCAAC CTGGGTGAAA GTCATGCATG ATTTTATAAT TGACTGATTT GTACTATTTT TTAGCAAATG CCTACTAAAT
TTGCCTCTTA CTGAGAAAAT GTTAATGGTG CAGAATTCTG GAAGCAAATT CCTCCAAATG AGCCTTATCG TGTCATACTT
GGTGGTGTCA GGGATAAATT GTACTATACG CGTGAACGTA CTCGCCATCT ATTGACAACT GGAGTTTCTG AAATTCCAGA
GGAGGCAACG TTTACTAATG TTGAAGAGGT AATCCTATTT ATCTTATATG TATCATTGTG AATGTCATTG TTGTACTTAT
AGTACTCAAT TATCACCCTC CTATCTTGCA GTTTCTGGAG CCGCTTGAGC TGTGCTACAG ATCATTATGT GCTTGTGGTG
ACAAACCTAT AGCTGATGGA AGCCTTCTTG ATTTCTTGCG TCAAGTATCA ACTTTTGGGC TGGCTCTTGT AAAACTTGAC
ATAAGGCAGG AGTCTGATCG ACACACTGAT GTCCTTGATG CCATAACTAC ATATCTTGGG ATTGGATCTT ACGCTGAATG
GTCTGAGGAG AAACGCCAGG ATTGGCTTTT GTCCGAACTA AGGGGCAAAC GTCCTTTGTT TGGTCCTGAT CTTCCTCAGA
CTGAAGAAAT TGCTGATGTT TTAGGAACAT TTCACGTCCT TGCTGAGCTC CCGGCAGATT GTTTTGGTGC TTACATCATC
TCAATGGCAA CTGCACCATC TGATGTGCTT GCTGTGGAGC TTCTACAGCG GGAGTGCCAT ATAAAACAGC CTCTGCGAGT
TGTTCCCCTA TTTGAGAAAC TTGCAGATCT TGAAGCAGCT CCAGCAGCGG TGGCACGACT ATTTTCAATA GACTGGTACA
TGAATAGGAT TAATGGCAAG CAGGAGGTCA TGATTGGATA CTCAGACTCT GGCAAGGATG CTGGTCGTCT TTCTGCAGCA
TGGCAAATGT ACAAAGCACA AGAGGAGCTT GTCAAGGTGG CAAAGCATTA TGGTGTAAAG TTGACAATGT TCCATGGAAG
AGGTGGAACA GTTGGCAGAG GAGGTGGTCC CAGTCATCTT GCCATATTAT CTCAACCACC AGACACGATA CATGGATCAC
TTCGTGTAAC AGTACAGGGC GAGGTTATTG AACACTCGTT TGGAGAGGAA CACTTGTGCT TTAGAACTCT GCAGCGCTTT
ACTGCAGCTA CTCTTGAGCA TGGAATGCAT CCTCCAATTT CCCCCAAACC AGAATGGCGT GCTCTAATGG ATGAGATGGC
TGTTGTGGCA ACAAAGGAAT ATCGATCAAT CGTCTTCAAG GAGCCACGGT TTGTTGAATA CTTCCGATCG GTAAGTTCAC
CTCTATTCTG AATTCTTTCC CATAAAATCT GCTGCAGTTC CGATAGGCGT AAATTTATGC TTAATTTCAA GGCTTCTTGA
CAAGACCATT CTCTAAGCTA ATTAGATATA CTCATGAGTT CTTTGCAGTT TGCATAGAGC GTGTGGTCTG ATGCGAAGTT
GCATGACAAA TGTGTGTAGG CCATGATAAT TTTTCTAAGC TTCATGTCCA CAGTTTTTTG CAATTTTACT TAACTATGAC
AAGGGATCAA ATACTAATGT AGAGATATGC TCCTTCTCCA TCAATAGGTG CACCTTCATG CTCCTTCTCC ATCAATAGGT
GCACCTTCAC ATTCTCTTGC CTGTGTTAAT CGACTAAGAA CTACCATATA GAAGGGATTG CATACATATT TTGGTTCTCT
GTTGTCAGTC ACTTCGTGCT TTATGTTATC TCTTATCTGA GCTAGATGTT GGTGGTGAAC ATGAAATTCT GACATGTGTG
TGTCCATCTG CTGTTCCAGG CAACACCTGA GACAGAATAT GGCAGGATGA ACATTGGTAG CCGACCATCA AAGAGAAAGC
CTAGTGGTGG CATTGAATCG CTCCGTGCAA TTCCTTGGAT TTTTGCTTGG ACACAAACTA GGTTTCATCT TCCTGTATGG
CTTGGATTTG GTGGAGCGTT CAAACATATA ATGCAGAAGG ATATCAGGAA CATCCATACA CTGAAAGAAA TGTACAATGA
GTGGCCATTC TTCAGGGTCA CCTTGGACTT GCTTGAGATG GTTTTCGCCA AGGGAGATCC AGGAATTGCT GCTTTATATG
ACAAATTGCT TGTGGCAGGT GATCTGCAAT CCTTTGGAGA GCAGCTGAGA AACAACTTTG AAGAGACAAA ACAGCTACTC
CTTCAGGTAA ACTACTCTAG AATAAGAATG GGCTATACTT AGATATTAAG TTTGCTTGCA TTTAAGCTGC ACCTTTCTTT
TTATCACCAG ATATTGGCTT TAACCCACAC CAGTGGTTCT TTTAGAGTTT TTCCTTGAGA TATATATGAT CCTGTTTGAT
GTGGATGATA TGATCCTGAA GAAATCATCA AAAGATTTAT GTTTGAAAAT TATACTGAAG ACAAATCTGG AACTACACCT
AGGCATTCTG AATCATAAAA ACAAACTCCA TGTTTTAAAT AAGAGTGCAC ATCATATCAT CACTGAATCT TTTCGCAGTC
TAAGTTGCGA CAACTGAGAT CTGAGAAGTT AGTGCCCTTG ACACATTGAA ATCATCTGCA GGTTGCCGGT CACAAGGATA
TTCTGGAAGG GGATCCTTAC CTGAAGCAGC GTCTGCGGCT GCGTGAGTCG TACATCACTA CCTTGAACGT TTGCCAAGCC
TACACCCTGA AGCGGATAAG GGACCCTAGC TTCGAGGTGA TGTCGCAGCC GGCCTTGTCG AAGGAGTTCG TCGACAGCAA
CCAGCCTGCC GAGCTGGTCC AACTGAACGC TGCGAGCGAG TACGCACCTG GCCTGGAGGA CACCCTCATC CTGACGATGA
AGGGCATTGC TGCCGGCATG CAGAACACAG GCTAGATTGT CCACAAGAAT GCTTCCAGCA GGTGCAATCA ATCAATCATC
AATAACTCCT TCCATGATGA GATGGTGAAT ATGTTTAACT AGTACGTTCG CCGATGCTAG TGAATTCTGG AGACTTTTTT
TTGCTCGCAC GTTTTCTTTT GGTTGTGTAC TTGATGTAAA TGTCAAGGGG GGACTTATTT GGCTTTTGCA GCCCGATCCA
AAATAAAATA TGGACCAATC ATTCTACGAA GCTTGATTCT GAACGCTTCG AATTTGCATC AGTGGTGACA GCGGCTGTGT
TTGCATCTTT AAACGACAGA CTAAAAGCAT TGTGCACCGC AAGATGCAGA CTTGACATGT GCTTATAGCA GAAGTATTAC
ATGGAGCACA TCTCAGGTGA GGGAAACCGG AACACACCTC TTCTTTCAAT GTGCTTATAG CAGATTTATT ACATGGAGCA
CATCTCTGTC TTTCTATCAA ATGATAGTCC TTGCGTATTA AGAAAGGGCT TTCTAGAGAT TCTACTGGTC CTGTTGGCAC
ATATGAAAGC AGCGAAATGC CTTACCTTTC AGCAAAGATT GCCCACTGTT AAAATGAAGG TTCTCTTGCA TACTTTAGGA
TGAGCAGAAA CAAATGGTTT TAGGGTGTAT TCATTTCTCC CCTTTCTTAA ATTTTCCTCT TTCGttttct acgcatacgt
ttactaaact gctaaatagt atgttttttt ttgaaaaaaa ttaaagtttt tttaactaat aattaattag tcacacatta
atgacttgct ccattttacg tgcgctaagg agaagatccc aaccATTCCA AATAAACACA ATATAGACTA TAGAGTTTCT
CCATATGTAA ATATCTTTTG ATCTTTTCAT TTATAAAAAA AATATTAACT ACTGGGTTTG ACTAGTAGTG TTGCTCCTTA
AAAAATTGTT AAGTCCTTTT TTAAGTCACT GAATGCACTT CCAGTAATTC AGATTACGAA ACTGAAGAGT ATCCATGACA
CTTCTAATAT CATTCTAGAT GGTCAAAAGA AATGCTTCTC GTAACATTTG TTTCTTTTTT TAAAATCTCA TTTGAGTGCA
TAACTTTATA CTTCCGCTGT TACATTAAAA AACCAATCTA AAATCGGAGA TTGATTTTTT TACGGGACAG ATGGAGTATG
TGCTATTTGT AGATATTTTA CTTCGTCATC TATGAACTGA ACTACCCATT TCTTGATGTG TCTTCTGCTC GGCCTGCCAT
CCATACTTTA GATCCATTCT TCGGGCTTGA TGGACATTTG GGCCCATTTC CATCCGTCCT GGACAGGACA GAAATACTTT
GAGCCCATTA ACTTCCTCGC TGGGAAGCCC ATAATTCTAG CCATTCAGAA ATGCTGTACA CTTTCTTTGG TTTATAGAAA
AAAAAACATA TGAATTTTat aggatactaa ctttccttta aaattcctat gaaatgataa accatttgga ttCTTCCATT
TACATCTTAC AACCCTATGT TATTCTACTA GTAATATATG CCTCTGCATT GGAATAGTCC CATATACCAC TATAATTAGA
CTGGTTATGT ATCTAACCTA AAGATTGCAA CGGGCCTATA ACACTGTGAA TAGGTTGACT GTACTCCCTC CGTAAACAGG
AGGAGCCCTA GGTTAGATTT TTTTTGGACG GAGAAAATAT TTCTTAACTA ACTACTTTTT ATTTGGAGTT TTCTTTTTTA
TGCGAGAGTA CGTGATGCAT GCCTAAGCAG TGAGGGAACC TGTTTGGGGG AGCTtaagac cctatttaga tgggactaaa
acttttaagt ccctatcaca tcggatattt agacactaat tataaatatt aaacgaagac tattaataaa acccatccat
aattttggac taattcgcga gacgaatcta ttgagcctaa ttaatccatg attagcctat gtgatgctac aataaacatt
ctctaattat agattaatta ggtttaaaaa attatctcac aaattagctt tcatttatgc aattagtatt gtaagtagtc
tatatttaat actctaaatt agtgtctaaa tacagagact aaagttaagt tcctggatcc aaacaccacc gaagattctg
agaagcagct gctgagaagc tagctgatga gaatctgaag aagctagaaa acccagcttc tggcttctag tttattttcc
agattctaca actgcagatt ctcagaatct ggataaaaag ctggactgtt tgggggagct tctagcaact ggagatttta
cgagaagttg cagctgttaa aagctcctct aaacaggccc GAGTTTTACT TTCTGTGTGA GTGCAGTGGG GAGGGAAAAC
CAGGAGTTCT TTTTTTTTTT TTTTGAGCGC GTTGTGCGCA AGCAGGGAAG AGGAGGATGG CTCCCCTTTT AAGATAGTAG
AGATGTCGTA CCCGGACATT GAAACATATT GTTTTGTTAT TTTCCCTTAG TTTTGAGTTT TAGGTGTTCC AAATGGTGTG
GCCTAGTTTG AAACATACTA TCATTTACTG GATTATTGTC GTAGATTTTA TCTACTTAAA AGTATAGGGG TAAGTTAAAT
AATTGAAGAA ATAAAATTAA GAAGTAAGAG ATCTACATTA TGCAGTAGAA GTATATTTTT TAGGAAAAAA AAATATTTTT
TAGTGGCGTA GAGTGAATAA TCCGTGGTAA TATTCTGGTA AAGTAGCTGA AAGCCTGAAA AGAACATGCT ATTAATATAT
GGTGGGCTGA TTTTGTTTGT CTCTAAGCCC ATTATTCGCC CATTCGTCAA TATAATAATA GGCACATTAT CTTTACGGAA
CTAGCTATGT CTTTGTCGAC AAATCCTTGG GTCAAAATCA CCCAGATTTT TTCCTACCGT TAGATTAAGA TCCAGAGGAC
ACAAAAAATG CTACATATTT TTTTCTCTGA CTAATCAGAT CACAAAACTA CATGGGCTCG AATTCTAGCC CATAGAACAA
TACAAAAAAT TATACAGGCC ATAACTGCAA ATACATCATG GCCCATAATG ATCAACTTCA CATCCAATAA AGGTTAGAAA
AAAACAAAAT AACACAGGGA GACCACACCA GTTCGCACAA ATCCCCTAGA TCGAGCAAAA CAAATCGAGC ACGCCATAGA
CAGTGAGGAG AACGAGAAAA AGAAGAAGAA GCAAATTCTT ACCAAGAACA TTGAGGTCAA GAAGTTGAAA TCAACAAGAC
ATAATCTTCC AGGTAACAAA TTACCTAGCA CAAAATCCAC CTTTACCTTT CCCCATTGAC TTCACCATAT TCTGCCAGTC
ATCTTTTAAA TCAAACAAAA AACAACTCAG TTCTGTAAAA ATATTGGAGA AAAGCACTTG GAATAGTGAA TTTCTTTTGG
AGAAAAGTGC TTGGAATAGG AAATTTCTTT AGATCAAGTA GTTAAAAGTA TGTAACTTTT TCAGAAAAAC TCGTAACAAA
AACTATCAAT CCATAGTCAG TTACAGTTAC AAATAACAAA AGTTACATAT ATAACTACAG TACATCTAAA CTGTAACTGG
GCTGTAAATG GAATCATTCT TAAATTTCTT AAAAAATTCA GTACTTATAC TGCGACATTA AAACATTTCC CCAATTATAA
CAAACTCTAA ATTATGTTAC AAATATATAA AGAGCTATCT ATCTATAGTC AGTTACAGTG AGAAATAACA AAAGTTACAG
ATGTAACTAC TGTACATCTA ACTGTAACTG GGTTGTAAAT GGAATCATTC TTAAATTTCT TTAAAAATTC AGTATTCATG
CAGCAACATT AAAACACTTT CCCCTAGTAT AACAAGCTCT AAATTATGTT ACAAATATAT AAAGAACTAT TTATCTACGG
TCAGTTACAG TGAGAAATAA CAAAAGTTAC AGATGTAACT ACAGTACATT TGAACAGTAA CTGGGTTATA ACTGGAATCA
TCCTTTGATT TTTTTTTAAA AAAATTCAGT ACTCATGCAC TAACTTTTTT TTTGCCTATG ACAAAATGTT CTAAATTATA
TTACAAATAA CCTAATCATG TAGGGTCAGG TATATTGCAA TCTCAAAAAT CAGGAGATAC ACAATCAGAT GGATATGAAA
TGAGAAGCAA AATTGTGTCT GAAGAAATGA GAAGCAAGAA GACAGTTAAA GGTGAGAATC ATTCTCACCT AGCATTATGG
ACCATTTTTT ATCTTGTCAG AAAATGTCAT CTAGCAAAAA TTTATATACA ACAAATTAGA GATAGTAGCA TGATAAATTT
TTAAAGAACT ATATATCTAT ATCCAGTTAC AGTGAGAAAT AACAGAAATT ACATATGTAA CTACAGTACA TATTGACTGT
AACTGGGCTT TAACTGCAAT CATGCTTGAA TTTCTTCAAA AAATTCAGTA CTCATGCAAC AGCATTAACA TTTTTTTACT
ATTATGACTT GTTCTAAATT GTACTACAAA TGATTGAAAC ATGCAACGCC TGATAGATTA GAAGCTCAAG CAACAGTGAA
TACAGAGTCA AATAGATGTC AAAGTGacaa aattttctca gaaaaattaa taagcaagaa gacacttgaa ggtcagaaca
atggacagat agcattatgc accaaatttg atcttgtcag tcataaaatc tagcacaatt ttgtatacat gaaagcatga
ttttttttTT TGAAAAACTA TCTATCTCCA GTTACAGTGA GAAGTAACAG AAGTTACATA TGTAACTACA GTACATATTG
ACTGTAACTG GGATGTAACT ACAATCATGC TTGAATTTCT TCAAAAAAAT TTTGTCTAAT ATACATTATC TAAATTATAT
TACAAATAAC CTATCTATGC AGGTTCTGTT ACAATTCGAT CTCAAGTAAC AGTGGATACA TAATCAGAGA GATCTGAAAG
AGATAACATT AATTTCGTCT GATGAAAAAA GAAGCAAGAA GACAACTAAA GGTCATAATC ATGATAACCT AGCATTATGG
TCCATATTTG ACCTTGACAG ACAATTTAAT CTAGCACATA TATTAGAGAT GGCGGCTTTG AAAAATCTAA AGACCTATCT
ATCTATAGTC AGTTACAGTG AGAAATAAGA AAAGTTACAT ATGTAACTAC ATTACATCTG AACTGTAACT AGGCTATAAC
AGCTTTCATG CTTGAATTTC TTCAAAAAAA ATTCAGTACT CATGCAGCAG CATTAAATAT TTTCCCCTAT TATAACAAGT
TCTAAATTAT GTTACAAATA ATATAAACAT GCAGGGTCTG ATGGGTTACA GTCTGAAAAA TCAGGGGATA TGCAATCGGA
GAGATATGAA AGTGACAAAA TTTTGTCCAG AGAAATAAGA AGCAAGAAAA CATTGAAAGG TCAGTTATCA TGCTCACCTA
GCATTATGCA CCATAAAATG ATCTTGGCAG ACAATATAAT CTAGCATAAA ATTATATACA ACAAATTAGA GATTGTAGCG
TTGATAAATT TTCAAGGACT ATATATCTAT AGTTAGTTAC AGTGAGAAAT AACAAAAGTT ACATATGTAA CTACAATACA
TATAGACTGT AACTGGGCTA AAACTGCAAG CATGCTTGAA TTTCTTCAAA AAATAAAGAA TTTCTTC