Os03t0113100-01

Locus

Os03g0113100

Description

Similar to Thymidine kinase.

Transcript Evidence

AK066124 (DDBJ, Best hit)

Protein Evidence

O81263 (UniProt)

CGSNL Gene Symbol

CGSNL Gene Name

CGSNL Gene Symbol Synonym(s)

CGSNL Gene Name Synonym(s)

Literature (PMID)

Manual Curation

Note

GO

Molecular Function: thymidine kinase activity (GO:0004797)

Molecular Function: ATP binding (GO:0005524)

InterPro

Thymidine kinase (IPR001267)

Thymidine kinase, conserved site (IPR020633)

KEGG

Os03t0113100-01 (EC:2.7.1.21)

KOME

J013057I21 (Online Clone Ordering)

RiceXPro Database

AK066124

Plant Gene Family Database (PGFD)

Os03t0113100-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os03t0113100-01

Transcript

1283 bp

>Os03t0113100-01 Similar to Thymidine kinase.
GTCCAGTCCAGTCTCCTCTCCTCTCTTCTCCTCTCCCGCCGCCGCCGCCGCCGCACCCGC
CGATCTCCATCCTGCGAGCAGCGGCGGCGCTCCACCTTTCCCTCCCCAAATTTCAAAACT
CGATTCGAAATCTGCCACGCTTTATTCCCGCCATCTCATTCTCACCTACCCAATTGTCTC
CTCCTCCTCAAATTTAGGTTGAAAAAGATATTCCCGGCGCCTCCCCACAATCAGCTAGCT
CTACAAATACCTCCCGCATGAGCTCCATTTGCGCCATGAGATCCCTCCTCGCCGCCTCCA
CCTTCCTCCGCTCCGGCGCTTCCCCTCTGCTGCGGCCCCTTTCCCGTCCTCTCCCTTCCC
GCCTGAATCTTTCCCGATTCGGTCCGGTGAGGCCGGTCTCTGCGGCGGCGGCGGCGGCGG
ACAAGTCTCGAGGCGGAGGCGGCTCCGCGATGGAGGCCCAGCCGTCGTATCCCGGTGAGA
TTCACGTCATCGTGGGCCCCATGTTCGCCGGGAAGACCACTGCCCTTCTCCGACGCGTGC
AGGTCGAGGCCGGCACTGGCAGCAGGAACGTGGCACTCATCAAGTCTGACAAGGACAATA
GGTATGGATTGGATTCTGTCGTAACTCATGATGGCACAAAGATGCCATGCTGGGCTCTAC
CTGAGCTTTCAAGTTTCCAAGATAAATTAGGAACAGAGGCTTACGATAAGGTTGATGTCA
TAGGTATTGATGAAGCACAGTTTTTTGACGATCTTCATGATTTCTGCTGCAAAGCTGCTG
ACCGTGATGGAAAAATTGTTGTAGTCGCAGGGCTAGATGGTGACTACAAAAGGAACAAAT
TTGGGTCAGTTCTGGACATTATACCCTTGGCTGACTCGGTCACCAAGCTCACCGCACGCT
GTGAGTTGTGCGGTCGCCGTGCATTCTTCACGCTGAGGAAGACACGGGAAACTAAGACCG
AGCTCATTGGAGGAGCTGATGTGTACATGCCTGTATGTAGGCAACACTACCTGGATGGTC
AGATTGTCATTGAGGCCACAAGGATTGTGCTGGATCTTGAAAAATCCAAGGTTATCCATG
CTTTCAAGTGAGTGAATAGCTCATTGTATCCTTTTTACTTGCAAGGCTTACCATGTGTAA
CACTATCATCATCAACCATGCAATCCATCTAGTTATCGTAGAAGATGATGGAAAGACCAC
AATATTCAGAGACTCTCCATTAAACGATTGTAAATATGTATCAGTCCAGATTCTGTTGGG
AATGAATTTTATCTTGGTTTGTG

CDS

834 bp

>Os03t0113100-01 Similar to Thymidine kinase.
ATGAGCTCCATTTGCGCCATGAGATCCCTCCTCGCCGCCTCCACCTTCCTCCGCTCCGGC
GCTTCCCCTCTGCTGCGGCCCCTTTCCCGTCCTCTCCCTTCCCGCCTGAATCTTTCCCGA
TTCGGTCCGGTGAGGCCGGTCTCTGCGGCGGCGGCGGCGGCGGACAAGTCTCGAGGCGGA
GGCGGCTCCGCGATGGAGGCCCAGCCGTCGTATCCCGGTGAGATTCACGTCATCGTGGGC
CCCATGTTCGCCGGGAAGACCACTGCCCTTCTCCGACGCGTGCAGGTCGAGGCCGGCACT
GGCAGCAGGAACGTGGCACTCATCAAGTCTGACAAGGACAATAGGTATGGATTGGATTCT
GTCGTAACTCATGATGGCACAAAGATGCCATGCTGGGCTCTACCTGAGCTTTCAAGTTTC
CAAGATAAATTAGGAACAGAGGCTTACGATAAGGTTGATGTCATAGGTATTGATGAAGCA
CAGTTTTTTGACGATCTTCATGATTTCTGCTGCAAAGCTGCTGACCGTGATGGAAAAATT
GTTGTAGTCGCAGGGCTAGATGGTGACTACAAAAGGAACAAATTTGGGTCAGTTCTGGAC
ATTATACCCTTGGCTGACTCGGTCACCAAGCTCACCGCACGCTGTGAGTTGTGCGGTCGC
CGTGCATTCTTCACGCTGAGGAAGACACGGGAAACTAAGACCGAGCTCATTGGAGGAGCT
GATGTGTACATGCCTGTATGTAGGCAACACTACCTGGATGGTCAGATTGTCATTGAGGCC
ACAAGGATTGTGCTGGATCTTGAAAAATCCAAGGTTATCCATGCTTTCAAGTGA

Protein

278 aa

>Os03t0113100-01 Similar to Thymidine kinase.
MSSICAMRSLLAASTFLRSGASPLLRPLSRPLPSRLNLSRFGPVRPVSAAAAAADKSRGG
GGSAMEAQPSYPGEIHVIVGPMFAGKTTALLRRVQVEAGTGSRNVALIKSDKDNRYGLDS
VVTHDGTKMPCWALPELSSFQDKLGTEAYDKVDVIGIDEAQFFDDLHDFCCKAADRDGKI
VVVAGLDGDYKRNKFGSVLDIIPLADSVTKLTARCELCGRRAFFTLRKTRETKTELIGGA
DVYMPVCRQHYLDGQIVIEATRIVLDLEKSKVIHAFK*

5'UTR

chr03:736183..736439 (+ strand) : 257 bp

CDS

chr03:736440..736744 (+ strand) : 305 bp

chr03:737593..737740 (+ strand) : 148 bp

chr03:738826..738947 (+ strand) : 122 bp

chr03:739315..739573 (+ strand) : 259 bp

3'UTR

chr03:739574..739765 (+ strand) : 192 bp

FASTA

>Os03t0113100-01 class=Sequence position=chr03:736183..739765 (+ strand)
GTCCAGTCCA GTCTCCTCTC CTCTCTTCTC CTCTCCCGCC GCCGCCGCCG CCGCACCCGC CGATCTCCAT CCTGCGAGCA
GCGGCGGCGC TCCACCTTTC CCTCCCCAAA TTTCAAAACT CGATTCGAAA TCTGCCACGC TTTATTCCCG CCATCTCATT
CTCACCTACC CAATTGTCTC CTCCTCCTCA AATTTAGGTT GAAAAAGATA TTCCCGGCGC CTCCCCACAA TCAGCTAGCT
CTACAAATAC CTCCCGCATG AGCTCCATTT GCGCCATGAG ATCCCTCCTC GCCGCCTCCA CCTTCCTCCG CTCCGGCGCT
TCCCCTCTGC TGCGGCCCCT TTCCCGTCCT CTCCCTTCCC GCCTGAATCT TTCCCGATTC GGTCCGGTGA GGCCGGTCTC
TGCGGCGGCG GCGGCGGCGG ACAAGTCTCG AGGCGGAGGC GGCTCCGCGA TGGAGGCCCA GCCGTCGTAT CCCGGTGAGA
TTCACGTCAT CGTGGGCCCC ATGTTCGCCG GGAAGACCAC TGCCCTTCTC CGACGCGTGC AGGTCGAGGC CGGCACTGGC
AGGTATTCCT TCTTCGCTGT TTCCTCACAA ATGGTAGGGC TACTTACTGG CTAGTGACAT CCCTCACCCA AAATCTTACA
TCTAACAACT CTATTACATG TTCTTATGTT AAAGGTGCTC GTTATCTAGT GATGTCCTGA TCCATGGTAT CAATGTAAAG
AGTACAGAAA ATACTTTAAC ATATagggtc tgttcagatt gatgccaaaa ttttggtaaa ttgacaacac tgtcaagttt
tggtagaata gactcaatat aatgttgcta aaattccata gacattacca atatttggta acaaactaaa tgcagccaca
tgattgccaa ttttactaaa ctaaataatg gtatgattta aaatgacatc aatctgaaca ggcTCATAAA CAAGAGTCTC
TGTGAATGTT TTGATGCCTT GTTGCAGATG GATGTGCTTT GAATTTTGAT TAGGGTGTCT GCTTTGTGGT ACAAAGTTTT
ATGTTAAATG GAGCTCTAAC ACGGCATGCG TGAAGAATTG Agggtctgtt tggttgttgc ctaacattgc cataactcaa
tttgccatag atgtggcatg gcaaacaaag tgtggccaac aatttgttgg tcacaagtgt ggcaatgttt agctagaaaa
tgagtatatg acatgtaggc ccatgaaaca agaaagtgtg gcttgccaca actgaaacaa gcaaccaaac gctaagctaa
caatctgtgg catgcctaac atgtggtgtg gcaatgtgtg gcaccaaacc aaacagcccc TTGAATGCCT AAGGAACTTT
GTTTCTTGAG TGGGTTATGC ACATTTTGAC ATTTTTCATC CCTTGAAAAG CAGGAACGTG GCACTCATCA AGTCTGACAA
GGACAATAGG TATGGATTGG ATTCTGTCGT AACTCATGAT GGCACAAAGA TGCCATGCTG GGCTCTACCT GAGCTTTCAA
GTTTCCAAGA TAAATTAGGA ACAGAGGCTT ACGATAAGGT AATCAATATT TTATATTTTT TTCTTTCACC AAACCGTTAG
TATAAAGAAT TAGAAAGCAT ATGCTGATAA GAATTATGAA TGCTATAGAG ACTTGAGTGT TTAATGTTGC ACATGGTAAG
TCAGGTACTG TAGCAGTATA TTGAAATATC ATGTAATGAG ATTTGACTCA TGCTTGATAT CCCTGGCCTT CAGAAGAAAT
GTTTGCACAA TCTGTCCATC TGAATCAAAG CAAGGACACC ATCACAAGTT GACTATACTT GGATATATCT TAGATTTAGC
TTGCCCTCTA AGTAGAAAAT AGATGATTAT CTGTTTCATT TTCCATGTGT GCCTAACATT ATACGAGAAC ATTTTGAGAA
CTTGGCAAAA GGTTTTGTCA TGTGGGTTGC ATGTACAGCT GCTGGCACTT GGCAGTTGCC ATGCCCCACA TGCCCAGCAC
ACAAGCTATT TTGGCTGCAT TTTAGGAGCA AGCTGTCTCC CTTAATTAGA TGATTTTGCT AGATACTCTT GTTCAATCCC
TATTTGGTAG CCCTTTTTCA CCATGGTATT GTTGATGGCA GGCTTAATAT CATTTTAGAA GCTAGAAAGA TAAAAATCCT
GATAATCTTC ACCTCTTTTC TCAGCCTTCA TCTAGGTCTG TCTTTTATGC AAATTGCCAT CTTTTTAAAT GATTCAGTGG
ACACATATAT GCTAGTATTT GGTATGAGGA TCAAACTATT ATACGATGAG TCAGTCATTA CAATGCCTCA TTCCTCAATT
TTCTACCACG CATGTGCTAT TCGGGGAAAT AAATGAGGAG TGGTAGCACA ATCCGTTCTA ATGCTCAAAC CAAATGAGGA
GTTAGGGTAG GATTGTCCTT GACTATCTTG TTTCTCAAAC CAATCATCTT GCTAGTTTGT TGGAAGtagg gattgcaatg
gggccctgac ccctgatacc tggtggggaa ttctcccatt aggggccagt gataggTATT TTATTTACAG TACAGTTGGA
TGTCATCTTA CATGGTGTAA CAAGGTAGTG TTAGAGCCAA CATAAAGATG AAAATATGGT AGTCACTGAA ATAACTCTTG
CAGGTTGATG TCATAGGTAT TGATGAAGCA CAGTTTTTTG ACGATCTTCA TGATTTCTGC TGCAAAGCTG CTGACCGTGA
TGGAAAAATT GTTGTAGTCG CAGGGCTAGA TGGTGACTAC AAAAGGTACT TACTGGATGA TTTATTTCAA ATCTAAACCG
AGGGTGAGTT TAGATCTCTA CCATACCAAA ATATGGTAGA CAATAACTGT ATCAAAAATT CCACATTACC AAAATTTTGG
TAATATACAC ACCTGTTCAT GTCACCGTAT TGCAATTTTG GCACAAAATA ACACATCCTT TCCATTTACA ACCTATCAAA
ATTACCCAAG CACTAGCAAA GTTTGGTACA GCATCAAACA ATAAGCTAGG ACTAGGCATG TTCTTTATCT GAATATTAGC
ACTAAACTCG TGGTAAATAG GATATTTGGA TGCAAAACCC AACATTTTCC AGTGAATATT GTGCTAGCAT TTGATGATTG
TGATACTGGC AGGAACAAAT TTGGGTCAGT TCTGGACATT ATACCCTTGG CTGACTCGGT CACCAAGCTC ACCGCACGCT
GTGAGTTGTG CGGTCGCCGT GCATTCTTCA CGCTGAGGAA GACACGGGAA ACTAAGACCG AGCTCATTGG AGGAGCTGAT
GTGTACATGC CTGTATGTAG GCAACACTAC CTGGATGGTC AGATTGTCAT TGAGGCCACA AGGATTGTGC TGGATCTTGA
AAAATCCAAG GTTATCCATG CTTTCAAGTG AGTGAATAGC TCATTGTATC CTTTTTACTT GCAAGGCTTA CCATGTGTAA
CACTATCATC ATCAACCATG CAATCCATCT AGTTATCGTA GAAGATGATG GAAAGACCAC AATATTCAGA GACTCTCCAT
TAAACGATTG TAAATATGTA TCAGTCCAGA TTCTGTTGGG AATGAATTTT ATCTTGGTTT GTG