Os03t0183600-00

Locus

Os03g0183600

Description

Similar to Alanine aminotransferase.

Transcript Evidence

Z26322 (DDBJ)

Protein Evidence

Q9S768 (UniProt)

CGSNL Gene Symbol

CGSNL Gene Name

CGSNL Gene Symbol Synonym(s)

CGSNL Gene Name Synonym(s)

Literature (PMID)

Manual Curation

Note

Gene structure and sequnce have changed between Build5 and IRGSP-1.0 assemblies.

GO

Biological Process: biosynthetic process (GO:0009058)

Biological Process: 1-aminocyclopropane-1-carboxylate biosynthetic process (GO:0042218)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: transferase activity, transferring nitrogenous groups (GO:0016769)

Molecular Function: 1-aminocyclopropane-1-carboxylate synthase activity (GO:0016847)

Molecular Function: pyridoxal phosphate binding (GO:0030170)

InterPro

1-aminocyclopropane-1-carboxylate synthase (IPR001176)

Aminotransferase, class I/classII (IPR004839)

Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (IPR015421)

Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (IPR015422)

Pyridoxal phosphate-dependent transferase, major domain (IPR015424)

Transcript

1461 bp

>Os03t0183600-00 Similar to Alanine aminotransferase.
TCAGTAAGTTGTGTTCTTTTGTGgcttgctgattcatattctttatttcaggttttacga
tgtgaatatgcagttcgtggagaggttgccatccatgctcagCACCTACAACAGCAGCTA
CAGACACAACCTGGTTCTCTTCCATTTGATGAGATCGTGTATTGCAACATCGGGAACCCT
CAGTCCTTGGGTCAAAAACCAATCACATTCTTCAGGGAGGTTCTTGCACTTTGCAATCAT
CCAAATCTGCTGGAGAGAGAGGAAATTAAATCATTGTTCAGcactgatgctattgctcgg
gcaaagaaaattctttccatgattcctggaagagccaccggggcatatagtcatagccag
ggtatcaagggactgcgtgatgagattgctgctgggattgcctcccgtgatggtttccct
gcaaatgcagatgatatattcctaactaatggagcaagtcctggtgtacacatgatgatg
cagttgctgataaggaacaacagagatggcattatgtgtccaattcctcaatactcattg
tactcagcatccctagcacttcatggcggagctcttgtgccatattatcttgatgaatcc
tcaggatggggtttggaggtttctaagcttaagaatcaacttgaagatgccaggtcaaaa
ggcataactgttagggcgttggtggtgatcaatcctggaaatcctactggacagattctt
gatgagcaacagcaatatgagctagtaaagttctgcaaggacgaggaacttgttcttctg
gcggatgaggtataccaagagaacatttatgttaccaacaagaagatcaactctttcaag
aagatagcaagatccatgggatacaatggagacgatttacaattagtatcattgcattct
gtttctaaaggatattacggagagtgtggcaagagaggcggttacatggaggtcactggc
ttcagcactccagttagagaacaactctacaaaattgcatctgttaacttgtgttcaaat
atcaccggccagatccttgcgagcctcataatggatccaccaaaggctggggacgcatct
tatgacctctacgaggaagagaaagacaacatcctaaaatctttatctcgtcgtgcaaag
gcaatggagtctgcatttaacagtattgatggaattacatgcaacaagacggaaggggcg
atgtatctgttcccacggatttatctaccacagaaggcaattgaggctgccagggctgtc
aacaaagcacctgatgtattctacgctctacgtcttcttgataccaccggcatcgttgtg
actcctggatctggttttggacaagttgcagggacatggcacgtgagatgcacgatcctg
ccgcaggaggagaagataccttcgatgatctcccgcttcagggaattccatgaggagttc
atgtcacagtatcgcgactGA

CDS

1461 bp

>Os03t0183600-00 Similar to Alanine aminotransferase.
TCAGTAAGTTGTGTTCTTTTGTGgcttgctgattcatattctttatttcaggttttacga
tgtgaatatgcagttcgtggagaggttgccatccatgctcagCACCTACAACAGCAGCTA
CAGACACAACCTGGTTCTCTTCCATTTGATGAGATCGTGTATTGCAACATCGGGAACCCT
CAGTCCTTGGGTCAAAAACCAATCACATTCTTCAGGGAGGTTCTTGCACTTTGCAATCAT
CCAAATCTGCTGGAGAGAGAGGAAATTAAATCATTGTTCAGcactgatgctattgctcgg
gcaaagaaaattctttccatgattcctggaagagccaccggggcatatagtcatagccag
ggtatcaagggactgcgtgatgagattgctgctgggattgcctcccgtgatggtttccct
gcaaatgcagatgatatattcctaactaatggagcaagtcctggtgtacacatgatgatg
cagttgctgataaggaacaacagagatggcattatgtgtccaattcctcaatactcattg
tactcagcatccctagcacttcatggcggagctcttgtgccatattatcttgatgaatcc
tcaggatggggtttggaggtttctaagcttaagaatcaacttgaagatgccaggtcaaaa
ggcataactgttagggcgttggtggtgatcaatcctggaaatcctactggacagattctt
gatgagcaacagcaatatgagctagtaaagttctgcaaggacgaggaacttgttcttctg
gcggatgaggtataccaagagaacatttatgttaccaacaagaagatcaactctttcaag
aagatagcaagatccatgggatacaatggagacgatttacaattagtatcattgcattct
gtttctaaaggatattacggagagtgtggcaagagaggcggttacatggaggtcactggc
ttcagcactccagttagagaacaactctacaaaattgcatctgttaacttgtgttcaaat
atcaccggccagatccttgcgagcctcataatggatccaccaaaggctggggacgcatct
tatgacctctacgaggaagagaaagacaacatcctaaaatctttatctcgtcgtgcaaag
gcaatggagtctgcatttaacagtattgatggaattacatgcaacaagacggaaggggcg
atgtatctgttcccacggatttatctaccacagaaggcaattgaggctgccagggctgtc
aacaaagcacctgatgtattctacgctctacgtcttcttgataccaccggcatcgttgtg
actcctggatctggttttggacaagttgcagggacatggcacgtgagatgcacgatcctg
ccgcaggaggagaagataccttcgatgatctcccgcttcagggaattccatgaggagttc
atgtcacagtatcgcgactGA

Protein

487 aa

>Os03t0183600-00 Similar to Alanine aminotransferase.
SVSCVLLWLADSYSLFQVLRCEYAVRGEVAIHAQHLQQQLQTQPGSLPFDEIVYCNIGNP
QSLGQKPITFFREVLALCNHPNLLEREEIKSLFSTDAIARAKKILSMIPGRATGAYSHSQ
GIKGLRDEIAAGIASRDGFPANADDIFLTNGASPGVHMMMQLLIRNNRDGIMCPIPQYSL
YSASLALHGGALVPYYLDESSGWGLEVSKLKNQLEDARSKGITVRALVVINPGNPTGQIL
DEQQQYELVKFCKDEELVLLADEVYQENIYVTNKKINSFKKIARSMGYNGDDLQLVSLHS
VSKGYYGECGKRGGYMEVTGFSTPVREQLYKIASVNLCSNITGQILASLIMDPPKAGDAS
YDLYEEEKDNILKSLSRRAKAMESAFNSIDGITCNKTEGAMYLFPRIYLPQKAIEAARAV
NKAPDVFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMISRFREFHEEF
MSQYRD*

CDS

chr03:4389209..4389310 (- strand) : 102 bp

chr03:4389053..4389103 (- strand) : 51 bp

chr03:4388911..4388976 (- strand) : 66 bp

chr03:4388774..4388835 (- strand) : 62 bp

chr03:4388540..4388618 (- strand) : 79 bp

chr03:4388057..4388161 (- strand) : 105 bp

chr03:4387868..4387978 (- strand) : 111 bp

chr03:4387648..4387785 (- strand) : 138 bp

chr03:4385933..4386007 (- strand) : 75 bp

chr03:4385689..4385809 (- strand) : 121 bp

chr03:4385453..4385607 (- strand) : 155 bp

chr03:4385291..4385365 (- strand) : 75 bp

chr03:4384995..4385198 (- strand) : 204 bp

chr03:4384585..4384701 (- strand) : 117 bp

FASTA

>Os03t0183600-00 class=Sequence position=chr03:4384585..4389310 (- strand)
TCAGTAAGTT GTGTTCTTTT GTGgcttgct gattcatatt ctttatttca ggttttacga tgtgaatatg cagttcgtgg
agaggttgcc atccatgctc agGTTTCGTG GTTTAGTCCA TCCATGTTCT GGAAGTCAAT TTCAATTTAT TCTTTTTCAG
CAAATGCTAG AAGAGAAATT AATAGATATC TCACATTTTT CTTCCAGCAC CTACAACAGC AGCTACAGAC ACAACCTGGT
TCTCTTCCAT TTGATGAGGT CATTGACAAC TATAATTTGC AGATCACGTG AATAATCGGT AGATGATTCA TAAATTTTCA
ACTATTATAT GCAGATCGTG TATTGCAACA TCGGGAACCC TCAGTCCTTG GGTCAAAAAC CAATCACATT CTTCAGGGAG
GTCTGTAAAT ATTAGACACC CAAAACTTCA TCTTTCCTTT TTATGCTCTT TCAGTATTTA CGAGTTATGT TACAGGTTCT
TGCACTTTGC AATCATCCAA ATCTGCTGGA GAGAGAGGAA ATTAAATCAT TGTTCAGGTA AACATCAACT GCATGCCATG
ATTCATTACC AAGCTATGAC TATACATATA TATTTATGTT CTACACTTTC TACATTTCTA ATAAAAAGGT ATGTAAGCAC
ATTAGGGTAT TTCATTTATG tatgatataa atgtttcttc atctctttgc agcactgatg ctattgctcg ggcaaagaaa
attctttcca tgattcctgg aagagccacc ggggcatata gtcatagcca ggtaaccatc tgccaattca cTCAACTAGG
AGCATCTTGA GTTCATAATT TTCCTTATAG TAAGTTTCAC TATAACTATG TTGTCAAAAC TATCGATTTC TGCAAATTTA
ACTACGCAAT AAGAATGCAA GAATAGCTGA TGATCTTATC AGAAAATTGC AACCTTATTT GATTGGTCTG GATCCATCTG
TCACACACAC ATGCAATACT CATGTCGTTG CAAGTTTGGG CCTACACATC AGAAACCAAT AGGAGATAAG GCTGCAGGTT
TCTGATAAAA TCCTCTGCTA TTGTTGCAGT TGTGTGAAAT ATTCAACAAA AGATGCAGAT TTAAATCAAA CACTGCAGTT
TTtgtggaat ttactcttct ttatcctagg gtatcaaggg actgcgtgat gagattgctg ctgggattgc ctcccgtgat
ggtttccctg caaatgcaga tgatatattc ctaactaatg gagcaagtcc tggtgtatgt cctaccttgg ttatttctga
agaaacagga atgtaagata ttccagtctg acttatgctt tccctcttct aggtacacat gatgatgcag ttgctgataa
ggaacaacag agatggcatt atgtgtccaa ttcctcaata ctcattgtac tcagcatccc tagcacttca tggcggagct
cttgtatgta gtttatttgt ctgacgttat aacttcaagc tagctactcg atgcagcgca atagcctgaa gacatttcat
ttcaggtgcc atattatctt gatgaatcct caggatgggg tttggaggtt tctaagctta agaatcaact tgaagatgcc
aggtcaaaag gcataactgt tagggcgttg gtggtgatca atcctggaaa tcctactgga caggtttgct ctcaccgctt
ctcctatcgt gtgcgattta aaacatcttA TATACAATTA TACAAGTATc tattatataa ttaaaggaat agaaaaagga
gcctccacgt tcgctctcat ggcctagaaa ttctcacatt aaacggagaa aaagaaaaaa caaagtccat atagaaatac
aatttagaaa tagctgaaat tcggaattaa aaaataagga atattaaaag aggagactag agtccatata gaaatacact
ttagaaatag ttgaaattcg gaattaaaaa ataaggaata ttagaagagg agtatagagc ccatataaaa atacaattag
gaaataatag aaattcagaa ttaaaaataa ggaatattag aagtagagta tagagtccat atagaaatac aattaggaaa
taatagaaat tctgaattaa aaataaggaa tattagaagt agagtataga gtccatatag aaatacaatt aagaaaaaaa
tagaaattca gaattaaaaa ataagaaata ttagaagtag agtatagagt ccatatagga atttaaaact aactaaaatt
cggaaaaaaa aaggagcctc cacgttcgct ctaatgacct agaaattctc acattaatcg gagaaaaaga aaaagcagag
tccgtataga aatacaattt agaaatagct gaaattcgga attaaaaaat aaggatatta aaagAGgaga ctagagtcca
tatagaaata caatttagaa atagctgaaa ttcgaaatta agaaataagg aatattagaa gaggagacta gagtccatat
agaaatacaa tttagaaata gttgaaattc ggaattaaaa aataaggaat attagaagag aagactagag tccatataga
aataaaatta ggaaataact gaaattcgga attaaaaata aggaatatta aaagtagagt atagagtcca tatagaaata
caattaggaa ataaccgaaa ttcggaatta aaaataagaa atattagaag tagagtatag agtccatata gaaatacaat
taagaaaaaa aatagaaata tggaattaaa aaataaggaa tattagaagT AGAGTATAGA GTTCATATTG GAATTTAAAA
CCAACTAAAA TTCGGAATaa aaaggagcct ccatgttcgc tctcatggcc tagaaattct cacattaatc agagaaaaag
aaaaggcaga gtctcagaga aaaagaaaag gcagagtcca tatagaaata caatttagaa atagctgaaa ttcagaatta
aaaaataagg aatattagaa gaGGAGACTA GAGTAGTTAT TACACATTAG TAGTTTtgaa aagttattgc aaaatttaaa
attatgttgt cattgtaata tattttataa taatataatg agaaaacata tatgctttta tatgagagaa aatataatga
tgctagccgc gcaatctacg cgggccacca tgctagttca tgattaagac aaagtGGCAC TGTTATTTTG TGATGTTTTT
CATGTCAGTA AGCATATGTT CCTTGATCCG AAGaagtatt taggttcaac tgatataaat attccaaaaa tcataattga
aatgttttta cattgttgtt aagattcttg atgagcaaca gcaatatgag ctagtaaagt tctgcaagga cgaggaactt
gttcttctgg cggatgaggt aaggctagtc atgttcaaag gtgtcagtgt gttgagtgat ataataatgt taacaaagta
tgatgttaac aaacacaaga gaaaactgtc cagataatcg ttttttgggg ggtgttgata ggtataccaa gagaacattt
atgttaccaa caagaagatc aactctttca agaagatagc aagatccatg ggatacaatg gagacgattt acaattagta
tcattgcatt ctgtttctaa aggtgaaatc ccatcatccg cctttctttc tccaagtaca ttgtaactcc ttaccacata
gatatttttt tgcctgccat caggatatta cggagagtgt ggcaagagag gcggttacat ggaggtcact ggcttcagca
ctccagttag agaacaactc tacaaaattg catctgttaa cttgtgttca aatatcaccg gccagatcct tgcgagcctc
ataatggatc caccaaaggt gcaataacat atctgtcctt acacgaaatg taattgccaa tatacactag attcataaca
cagagagacc atgcatattg tgcaggctgg ggacgcatct tatgacctct acgaggaaga gaaagacaac atcctaaaat
ctttatctcg tcgtgcaaag gtgtgtggag tttactttta acagattcac ttcttgctat ctatgcagac acttgagcta
agacatcatt ttgtctggaa tctggatcac aggcaatgga gtctgcattt aacagtattg atggaattac atgcaacaag
acggaagggg cgatgtatct gttcccacgg atttatctac cacagaaggc aattgaggct gccagggctg tcaacaaagc
acctgatgta ttctacgctc tacgtcttct tgataccacc ggcatcgttg tgactcctgg atctggtttt ggacaagtga
gctactttct actcttgatc tttgaaccat agtgatatgt gctgtctgaa tcccacagaa tgataagtga actgttttgg
ggaacggctg aagctcacgc agcacaatct atattcctga agagtctggt agtagtagta gtctcgttct acaagaacag
atagcaccaa ttaaaaaaaa aacaataaca gatagcaacc gttttttcta ccatttcaga tcatcagatg ttatctgttc
acctgcaatt ctgaattcct gaccactcaa gtttggtcct ttgtgaaagg ttgcagggac atggcacgtg agatgcacga
tcctgccgca ggaggagaag ataccttcga tgatctcccg cttcagggaa ttccatgagg agttcatgtc acagtatcgc
gactGA