Os03t0219200-01

Locus

Os03g0219200

Description

Similar to Superoxide dismutase (EC 1.15.1.1).

Transcript Evidence

AK073785 (DDBJ, Best hit)

Protein Evidence

Q10PW4 (UniProt)

CGSNL Gene Symbol

SOD2

CGSNL Gene Name

SUPEROXIDE DISMUTASE 2

CGSNL Gene Symbol Synonym(s)

OsSOD2

CGSNL Gene Name Synonym(s)

superoxide dismutase 2

Literature (PMID)

Manual Curation

Note

GO

Biological Process: superoxide metabolic process (GO:0006801)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: superoxide dismutase activity (GO:0004784)

Molecular Function: metal ion binding (GO:0046872)

InterPro

Superoxide dismutase, copper/zinc binding domain (IPR001424)

Superoxide dismutase, copper/zinc, binding site (IPR018152)

Superoxide dismutase (Cu/Zn) / chaperones (IPR024134)

KEGG

Os03t0219200-01 (EC:1.15.1.1)

KOME

J033068D19 (Online Clone Ordering)

RiceXPro Database

AK073785

Oryzabase

11521

Plant Gene Family Database (PGFD)

Os03t0219200-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os03t0219200-01

Transcript

798 bp

>Os03t0219200-01 Similar to Superoxide dismutase (EC 1.15.1.1).
AGGGAAAGCCGGCGGCCTCAAGGGCGTCGCCCTCATCGGCGGCGCCGGCGGCAACAGCGC
GGTCGCCGGCGCCCTCCACTTCTTCCAGGACCCCTCCACCGGGTATACCGAGGTGAGGGG
GAGGGTCACCGGCCTCGCTCCGGGCCTCCATGGCTTCCACATCCACTCCTTTGGCGACAC
CACCAACGGCTGCAACTCTACCGGGCCCCATTTTAATCCTCACAATAAGTCCCATGGGGC
ACCATCTGATGATGAAAGACATGTGGGCGACCTGGGAAACATAGTAGCCAACAAAGATGG
TGTTGCAGATATCTTCATAAAGGACCTACAGATTTCACTAAGCGGGCCTCATTCCATATT
GGGAAGGGCAGTTGTTGTTCATGCTGATTCTGATGACCTAGGAAGGGGTGGTCATGAACT
CAGTAAAACAACAGGAAATGCAGGAGCAAGAATTGGATGCGGTATCATTGGACTTCGATC
TGCAGTTTAACAATCTATAGTCATGAAGCTTGAGGTGGTGGTGGTATGCTGTTCAGAGAT
ATGGAAATCATTGGCGCTCCTCATTCCAGACTGTTTCAAGAATGGCTTTTGACGTGTTAT
CACTGCCTTCAGTTATCTATACGTACTTTGTTACGGAGTATATTCTTTTTTTGAACGAAC
ATACGGAGTATATTCTATAAATAAAGGAAAAGTTTCCTCATACTTATACTGTACCTTGGA
CTGAAGCTGTGCAAACTCACAATAATGTGTTACTATTTCTCAATCTTCAGCTTACAAGCG
ATGCTGCTTTGAATTTGG

CDS

489 bp

>Os03t0219200-01 Similar to Superoxide dismutase (EC 1.15.1.1).
GGGAAAGCCGGCGGCCTCAAGGGCGTCGCCCTCATCGGCGGCGCCGGCGGCAACAGCGCG
GTCGCCGGCGCCCTCCACTTCTTCCAGGACCCCTCCACCGGGTATACCGAGGTGAGGGGG
AGGGTCACCGGCCTCGCTCCGGGCCTCCATGGCTTCCACATCCACTCCTTTGGCGACACC
ACCAACGGCTGCAACTCTACCGGGCCCCATTTTAATCCTCACAATAAGTCCCATGGGGCA
CCATCTGATGATGAAAGACATGTGGGCGACCTGGGAAACATAGTAGCCAACAAAGATGGT
GTTGCAGATATCTTCATAAAGGACCTACAGATTTCACTAAGCGGGCCTCATTCCATATTG
GGAAGGGCAGTTGTTGTTCATGCTGATTCTGATGACCTAGGAAGGGGTGGTCATGAACTC
AGTAAAACAACAGGAAATGCAGGAGCAAGAATTGGATGCGGTATCATTGGACTTCGATCT
GCAGTTTAA

Protein

163 aa

>Os03t0219200-01 Similar to Superoxide dismutase (EC 1.15.1.1).
GKAGGLKGVALIGGAGGNSAVAGALHFFQDPSTGYTEVRGRVTGLAPGLHGFHIHSFGDT
TNGCNSTGPHFNPHNKSHGAPSDDERHVGDLGNIVANKDGVADIFIKDLQISLSGPHSIL
GRAVVVHADSDDLGRGGHELSKTTGNAGARIGCGIIGLRSAV*

5'UTR

chr03:6275334..6275334 (- strand) : 1 bp

CDS

chr03:6275234..6275333 (- strand) : 100 bp

chr03:6275004..6275105 (- strand) : 102 bp

chr03:6273927..6274022 (- strand) : 96 bp

chr03:6273782..6273813 (- strand) : 32 bp

chr03:6273614..6273689 (- strand) : 76 bp

chr03:6272477..6272530 (- strand) : 54 bp

chr03:6272267..6272295 (- strand) : 29 bp

3'UTR

chr03:6271959..6272266 (- strand) : 308 bp

FASTA

>Os03t0219200-01 class=Sequence position=chr03:6271959..6275334 (- strand)
AGGGAAAGCC GGCGGCCTCA AGGGCGTCGC CCTCATCGGC GGCGCCGGCG GCAACAGCGC GGTCGCCGGC GCCCTCCACT
TCTTCCAGGA CCCCTCCACC GGTACGCGTC TCCTCCCTGT AGCTCCGTGC TGTTCGCCTG CGCGCACAGC AGCTCGTCTC
GTAAGTGAAT TGACCTCTTC TCGCTGATGT GATTTTGGTG GACTACTCGA TCTCTGCGTG GTTTTTTAGG GTATACCGAG
GTGAGGGGGA GGGTCACCGG CCTCGCTCCG GGCCTCCATG GCTTCCACAT CCACTCCTTT GGCGACACCA CCAACGGCTG
CAACTCTACC GGTTCGTTGC CTTCCGTTTC CCTTGCTTGG TTTTGTGACT TAGGTTGTGA AATTGATGGG GGATTTGGCC
ATTTGGAGCA CTGCTCGATA AGATCGTGTA TTGCAATTGT GAACTCGCAT ACTCCTATAT TATGTATAAG TAGAACTTAC
AACGCTAACT ACCATAAGAG AAGATAGGCA TCTAATTTGA GTTGACTGCT GATCAAAACA TGGATAGGAC GAAAACGTCA
CTGAGGTAGG AACTTCGTTT ACCAATTGAG TTGTGCTGTG AAGAATTATC AAATGACCGA TTTATTTGTT AAAAAGTGCA
CTGGACAAAA CTTTTTTTTT TGTCGGGACG GCCAAAGATA GGCCGGCCAA TTTCATTAAG ATTGGGGGAA ATAAAGTTTT
AATTACAACG ACATGAAGGA TGTCGCGCCG GTCTCAAGCA AACTCAAGCA CTGGACAAAA CTGTTGGTTG TATTTATGTG
TGCACTACAA AAAGAGATTG TCACGCCTCC CGCAGAGTTT TTATGAGTTA CAATGCCTTC GGCAAGCCTA TGGAAACACT
ACTATTAGCC TTTGCCCAAT GAATGATGGA TCATGGAATG GGTAGTGAGT GTACTCAGGT GAAAGTTTTG GGGAACTGCA
TAAGCTCAAT GTATGCTGCA AAAAATGTTT CCAATACAGA ATCATCTGCT CACCCTTCCA TTCTAATTGT CCTGTTCAAA
TCTTGCTACT GCATTTTTAA GTGAATGGTT TTCATTTCTT TTATTTAGGG TTTGTTTTTC ATGAAAATTT GACTTTTTTC
TTCTTCACGT GTACGGGGTC TATATTTGAA ATGTTATGGA GAGATGGATA ACATCAAACT CTATGTTACT AGATTTATTT
GAGAATTTTC ATAACCCAAG TTGGGGGTGC TCCATGGAGC AGCTGAAGTG TTCTCTCATG CCATCTTGCA ATTGTTATTT
TTCATTTGTT CTGATTAAAT TACTTGTCCC AGGGCCCCAT TTTAATCCTC ACAATAAGTC CCATGGGGCA CCATCTGATG
ATGAAAGACA TGTGGGCGAC CTGGGAAACA TAGTAGCCAA CAAAGATGGT TAGCACTCTG TCAGGCCGTC TACATTAAGA
CCTTTGAGGC AACTAACGCA AAGAAACTTT GTAAATTAAT TCATGTGTGT CTACCAATAA TACATCACCT TTTTGTTCCA
GGTGTTGCAG ATATCTTCAT AAAGGACCTA CAGGTTCCAT TGTCTTGAAA TATGTAAAAT ATCAGTTTGT TCATCTTATT
GTTTATGCTA ATGCATTGGT AATTCATATT CATTGCTTTG TGAAGATTTC ACTAAGCGGG CCTCATTCCA TATTGGGAAG
GGCAGTTGTT GTTCATGCTG ATTCTGATGA CCTAGGAAGG GGTAAGCATT ATGTCATTAC TCTTGCAAGA TTGTTATTGG
TCATTCAGAA TTGAAGAGAA GTCTCCCTTC CTACATTATA TATGTCCTCT TATTTTAGAA AATATTGAAT TCACTATTTA
GAGGGTAATT TAGAGCTTAT TACCTGCCGA ATGGCGTGCT ATCATGCATT TGAATATTCA TATAACTATT TAACGTAGAA
GTTCCCTTGT TAGCTATGGT TGATATGGGA TTATTCGGTG TTCCAAAGCT GCCTGAGATT TGGCTCTTCA ACCTTGAGTG
TAACTACTAG TAAAAATCAT ATTCATAAGA CAGGTAATCC CTCCCAAGCC CAACTAACCT GGGATATGCT GAATTGCTGA
TAGCTGTCAT GAAATTATTG TGGACTGTGG TACTATGTTA ACATACAGTA GGGTATAAAT CATAATCCAG TAGGCAAGGG
CCCAAAACAG GTCCAGATAA CAGGATTTGC ATGGGCTGTA CCATGCTGCA GTTCAAAATC TAACTGCCCA TGGGCTGTAC
AATGCTACAG GTCAAAAATC TAATTGCCAG TCTCTGTTCC TCTGCTGCAT TTATGCTAGG TTTGTGGTAG CAGACAAATG
TTACTGTGGT GCCTTAAGAA ATACATTTCT AGCAATCTAG ATCTAGGATT CTGGCACTAT CTATGCTGCA TTGTTTTGCC
AATTATTTTC AGTGCCTCCA GAGGCCTTTT TATACATTAT TTGTGCAAGA CATGTCCTAG GAGTTGGGAT GATAAAGCTC
TTGCCATTAC CATCAATAAC TGCGTCATAC TCAATTCTGA ACAACATCTG TTTGTGTCCA ATTATTTAAG TATGAAATAT
TTTGGTATAA TATTTTTCTC TCCTGTTCAA ACTCTATGTT CCATTTGTTA ACAATTGGCT AACTTTGACT AGTGGTAGGT
TCCAAAATAC ATGCTCAAGT ATCCATCAGT TGAGTCAAAT TACGGATTGC GAGCCTAATG TTAGAATAGG TTTCATGCAC
AATTATGTTT TGCCATTTAG TATCACATGG TGAAGCATTC ACTTTTTATG CTGCTGCTCA TTGTACTACT TTGATATTTT
GAAGGTGGTC ATGAACTCAG TAAAACAACA GGAAATGCAG GAGCAAGAAT TGGATGCGGT AAGTGAGAAT CTTTTTGTAG
TTTCTGAAAC TGAGAGGAGG AAAGAACCAT TCGGACATAC TAGTACTCAG GAACACATAG GACAAATATT GTACAAAATA
AAAAGAAACT TTTTTTTTCT CTGCAAGACC GATCCTTCCA GTGGAATGAC AAGCTAATAT GTCTGCTAAT AACTTGTAGG
TATCATTGGA CTTCGATCTG CAGTTTAACA ATCTATAGTC ATGAAGCTTG AGGTGGTGGT GGTATGCTGT TCAGAGATAT
GGAAATCATT GGCGCTCCTC ATTCCAGACT GTTTCAAGAA TGGCTTTTGA CGTGTTATCA CTGCCTTCAG TTATCTATAC
GTACTTTGTT ACGGAGTATA TTCTTTTTTT GAACGAACAT ACGGAGTATA TTCTATAAAT AAAGGAAAAG TTTCCTCATA
CTTATACTGT ACCTTGGACT GAAGCTGTGC AAACTCACAA TAATGTGTTA CTATTTCTCA ATCTTCAGCT TACAAGCGAT
GCTGCTTTGA ATTTGG