Os03t0236200-01

Locus

Os03g0236200

Description

Similar to Glutamate decarboxylase isozyme 3 (EC 4.1.1.15).

Transcript Evidence

AK071556 (DDBJ, Best hit)

Protein Evidence

Q1I1D8 (UniProt)

CGSNL Gene Symbol

GAD3

CGSNL Gene Name

GLUTAMATE DECARBOXYLASE

CGSNL Gene Symbol Synonym(s)

OsGAD3

CGSNL Gene Name Synonym(s)

glutamate decarboxylase 3

Literature (PMID)

Manual Curation

Note

GO

Biological Process: glutamate metabolic process (GO:0006536)

Biological Process: carboxylic acid metabolic process (GO:0019752)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: glutamate decarboxylase activity (GO:0004351)

Molecular Function: carboxy-lyase activity (GO:0016831)

Molecular Function: pyridoxal phosphate binding (GO:0030170)

InterPro

Pyridoxal phosphate-dependent decarboxylase (IPR002129)

Glutamate decarboxylase (IPR010107)

Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (IPR015421)

Pyridoxal phosphate-dependent transferase, major domain (IPR015424)

KEGG

Os03t0236200-01 (EC:4.1.1.15)

KOME

J023101A16 (Online Clone Ordering)

RiceXPro Database

AK071556

Oryzabase

7055

Plant Gene Family Database (PGFD)

Os03t0236200-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os03t0236200-01

Transcript

2017 bp

>Os03t0236200-01 Similar to Glutamate decarboxylase isozyme 3 (EC 4.1.1.15).
ACACCAAAACAACTCGCATCCGTTTCGTTCAAGTCCCCCCCCGAAAAGAGCTTAGTAGAA
GCGCGCCACAGAGCCTTCTCGACCTGGCTCTCCTCTAGCCACCTCTGCTTCTTCTTCTTC
TTCTTCTTCTTCTTCGTCTGATCGCCACCGAGGCTAAAGCCACCAGGAGGAGCAGGTTGA
TAGCTCGGCAGGCAAGATGGTGCTCTCCAAGGCCGTCTCCGAGAGTGACATGTCCGTGCA
CTCCACCTTCGCCTCCCGCTACGTCCGCGCCTCCCTCCCAAGGTACCGGATGCCGGAGAA
CTCGATCCCGAAGGAGGCGGCGTACCAGATCATCAACGACGAGCTGATGCTGGACGGCAA
CCCGCGGCTGAACCTGGCGTCGTTCGTCACCACGTGGATGGAGCCCGAGTGCGACAAGCT
CATCATGGCCGCCATCAACAAGAACTACGTCGACATGGACGAGTACCCCGTCACCACCGA
GCTCCAGAACCGGTGCGTGAACATGATCGCGCACCTGTTCCACGCGCCGCTCGGGGAGGA
CGAGACGGCGGTGGGCGTGGGCACGGTGGGTTCGTCGGAGGCCATCATGCTGGCCGGGCT
GGCCTTCAAGCGGCGGTGGCAGAACAAGCGCAAGGCCGAGGGGAAGCCGTTCGACAAGCC
CAACATCATCACCGGCGCCAACGTGCAGGTGTGCTGGGAGAAGTTCGCCCGCTACTTCGA
GGTGGAGCTCAAGGAGGTGAAGCTCCGCGACGGCTACTACGTCATGGACCCCGAGAAGGC
CGTCGACATGGTCAACGAGAACACCATCTGCGTCGCCGCCATCCTCGGCTCCACCCTCAA
CGGCGAGTTCGAGGACGTCAAGCTACTCAACGACCTCCTCGACAAGAAGAACAAGGAGAC
TGGGTGGGAGACGCCGATCCACGTGGACGCGGCGAGCGGCGGGTTCATCGCGCCGTTCCT
GTACCCGGAGCTGGAGTGGGACTTCCGGCTGCCGTGGGTGAAGAGCATCAACGTGAGCGG
TCACAAGTACGGGCTCGTCTACGCCGGCATCGGCTGGTGCATCTGGCGCAACAAGGAGGA
CCTGCCCGAGGAGCTCATCTTCCACATCAACTACCTCGGCACCGACCAGCCAACCTTCAC
CCTCAACTTCTCCAAGGGCTCCAGCCAGGTCATCGCCCAGTACTACCAGCTCATCCGCCA
CGGCTTCGAGGGGTACAGGAACATCATGGAGAACTGCCACGAGAACGCGATGGTGCTGAA
GGAAGGGCTGGTGAAGACGGGGAGGTTCGACATCGTGTCCAAGGACGAAGGGGTGCCGCT
GGTGGCGTTCTCGCTCAAGGACCGGAGCCGGCACGACGAGTTCGAGATCTCCGACATGCT
GCGCCGCTTCGGCTGGATCGTGCCGGCGTACACCATGCCGCCCGACGCCCAGCACGTCAC
GGTGCTCCGCGTGGTCATCCGGGAGGAGTTCAGCCGCACCCTCGCCGAGCGCCTCGTCCT
CGACATCGAGAAGGTGATGTACCAGCTCGACGCGCTCCCCTCCAGGCTCATGCCCCCCGT
GCCGCCGGCGCCGCTGCTGGTGGTCGCCAAGAAGTCGGAGCTCGAGACGCAGCGGTCGGT
GACGGAGGCGTGGAAGAAGTTCGTGCTCGCCAAGAGGACCAACGGCGTCTGCTAGTCTCA
ATTAGCGACAGCGCCACGGCCTACAAATCCACAAATCAAGACGCTGCTGATTGATATGAT
TAATTACATTCATGGTGTGAGCTACCATTACTGTATTTTTTTTTTACCGTGCTAATTTGA
GTGGAGCCTTCGATTCTAGGTCCAAGGTACTAGTAGAGTTCATAACCAAAAGCCATGCTC
TTGCTTTTGTTTCTCCTTCTGATAATCTGTGCAGCTGCGCTGCAGCCTGCACTCATCTCC
CGAGAGTTGTAAGTTGAAACTGTACGATTTTGATGTTCCCTGTTCTAGTGTAAGTGCCAA
TTATTGAGTGGTATGGAAAATATTTCTTCAAGAAACC

CDS

1479 bp

>Os03t0236200-01 Similar to Glutamate decarboxylase isozyme 3 (EC 4.1.1.15).
ATGGTGCTCTCCAAGGCCGTCTCCGAGAGTGACATGTCCGTGCACTCCACCTTCGCCTCC
CGCTACGTCCGCGCCTCCCTCCCAAGGTACCGGATGCCGGAGAACTCGATCCCGAAGGAG
GCGGCGTACCAGATCATCAACGACGAGCTGATGCTGGACGGCAACCCGCGGCTGAACCTG
GCGTCGTTCGTCACCACGTGGATGGAGCCCGAGTGCGACAAGCTCATCATGGCCGCCATC
AACAAGAACTACGTCGACATGGACGAGTACCCCGTCACCACCGAGCTCCAGAACCGGTGC
GTGAACATGATCGCGCACCTGTTCCACGCGCCGCTCGGGGAGGACGAGACGGCGGTGGGC
GTGGGCACGGTGGGTTCGTCGGAGGCCATCATGCTGGCCGGGCTGGCCTTCAAGCGGCGG
TGGCAGAACAAGCGCAAGGCCGAGGGGAAGCCGTTCGACAAGCCCAACATCATCACCGGC
GCCAACGTGCAGGTGTGCTGGGAGAAGTTCGCCCGCTACTTCGAGGTGGAGCTCAAGGAG
GTGAAGCTCCGCGACGGCTACTACGTCATGGACCCCGAGAAGGCCGTCGACATGGTCAAC
GAGAACACCATCTGCGTCGCCGCCATCCTCGGCTCCACCCTCAACGGCGAGTTCGAGGAC
GTCAAGCTACTCAACGACCTCCTCGACAAGAAGAACAAGGAGACTGGGTGGGAGACGCCG
ATCCACGTGGACGCGGCGAGCGGCGGGTTCATCGCGCCGTTCCTGTACCCGGAGCTGGAG
TGGGACTTCCGGCTGCCGTGGGTGAAGAGCATCAACGTGAGCGGTCACAAGTACGGGCTC
GTCTACGCCGGCATCGGCTGGTGCATCTGGCGCAACAAGGAGGACCTGCCCGAGGAGCTC
ATCTTCCACATCAACTACCTCGGCACCGACCAGCCAACCTTCACCCTCAACTTCTCCAAG
GGCTCCAGCCAGGTCATCGCCCAGTACTACCAGCTCATCCGCCACGGCTTCGAGGGGTAC
AGGAACATCATGGAGAACTGCCACGAGAACGCGATGGTGCTGAAGGAAGGGCTGGTGAAG
ACGGGGAGGTTCGACATCGTGTCCAAGGACGAAGGGGTGCCGCTGGTGGCGTTCTCGCTC
AAGGACCGGAGCCGGCACGACGAGTTCGAGATCTCCGACATGCTGCGCCGCTTCGGCTGG
ATCGTGCCGGCGTACACCATGCCGCCCGACGCCCAGCACGTCACGGTGCTCCGCGTGGTC
ATCCGGGAGGAGTTCAGCCGCACCCTCGCCGAGCGCCTCGTCCTCGACATCGAGAAGGTG
ATGTACCAGCTCGACGCGCTCCCCTCCAGGCTCATGCCCCCCGTGCCGCCGGCGCCGCTG
CTGGTGGTCGCCAAGAAGTCGGAGCTCGAGACGCAGCGGTCGGTGACGGAGGCGTGGAAG
AAGTTCGTGCTCGCCAAGAGGACCAACGGCGTCTGCTAG

Protein

493 aa

>Os03t0236200-01 Similar to Glutamate decarboxylase isozyme 3 (EC 4.1.1.15).
MVLSKAVSESDMSVHSTFASRYVRASLPRYRMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFHAPLGEDETAVG
VGTVGSSEAIMLAGLAFKRRWQNKRKAEGKPFDKPNIITGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPEKAVDMVNENTICVAAILGSTLNGEFEDVKLLNDLLDKKNKETGWETP
IHVDAASGGFIAPFLYPELEWDFRLPWVKSINVSGHKYGLVYAGIGWCIWRNKEDLPEEL
IFHINYLGTDQPTFTLNFSKGSSQVIAQYYQLIRHGFEGYRNIMENCHENAMVLKEGLVK
TGRFDIVSKDEGVPLVAFSLKDRSRHDEFEISDMLRRFGWIVPAYTMPPDAQHVTVLRVV
IREEFSRTLAERLVLDIEKVMYQLDALPSRLMPPVPPAPLLVVAKKSELETQRSVTEAWK
KFVLAKRTNGVC*

5'UTR

chr03:7181080..7181275 (+ strand) : 196 bp

CDS

chr03:7181276..7181361 (+ strand) : 86 bp

chr03:7181474..7181678 (+ strand) : 205 bp

chr03:7182331..7182746 (+ strand) : 416 bp

chr03:7182833..7183139 (+ strand) : 307 bp

chr03:7183230..7183694 (+ strand) : 465 bp

3'UTR

chr03:7183695..7184036 (+ strand) : 342 bp

FASTA

>Os03t0236200-01 class=Sequence position=chr03:7181080..7184036 (+ strand)
ACACCAAAAC AACTCGCATC CGTTTCGTTC AAGTCCCCCC CCGAAAAGAG CTTAGTAGAA GCGCGCCACA GAGCCTTCTC
GACCTGGCTC TCCTCTAGCC ACCTCTGCTT CTTCTTCTTC TTCTTCTTCT TCTTCGTCTG ATCGCCACCG AGGCTAAAGC
CACCAGGAGG AGCAGGTTGA TAGCTCGGCA GGCAAGATGG TGCTCTCCAA GGCCGTCTCC GAGAGTGACA TGTCCGTGCA
CTCCACCTTC GCCTCCCGCT ACGTCCGCGC CTCCCTCCCA AGGTACGTGC TCTCGATCTG CTCTCTCTCT GTTCTTGCTG
TTCTTGGCCC AATGCAGAGC TTCTTCCAAT ATTTCATGGC TGACTCGATG GGATTGATCG ATTGGTGTTA TTAGGTACCG
GATGCCGGAG AACTCGATCC CGAAGGAGGC GGCGTACCAG ATCATCAACG ACGAGCTGAT GCTGGACGGC AACCCGCGGC
TGAACCTGGC GTCGTTCGTC ACCACGTGGA TGGAGCCCGA GTGCGACAAG CTCATCATGG CCGCCATCAA CAAGAACTAC
GTCGACATGG ACGAGTACCC CGTCACCACC GAGCTCCAGG TACAGCACCC TGCAGGCATC TCTGCTTCGT TGAATTTTCT
CCTATCACCT CGCGTTTTCT CGCCGCCGCG CGCGGCTCGA ATGCACACTG GAAATCCCCG GATTTTTGGT CGATAAAACC
GGCTTGGCCA GTTGGCCTGG CCTGGCAGAT TGGTGATAAG AATCTCAGGC TAGAAACTTT ATTTCCGAGT TTATCATTTG
CGTCATTCAC GGGAGGCAGA ATGGGGGAAG AACATGGCAC AGTTTCCGAG ATGATCACCA ATTCGCATTA GAAAAAATAT
ATAGGAAGTC CAATAAATAA AGTAAGGGGA TGGGAAGAAT GATCACCATA TCTCTTCATT TTTCGCATTA AAATATGGAA
GGTGCATGAA TGAAGGGAAA TGGGAAAGAA TAATGCTTGG TTTGGTCAAA ACAGGGCAAG AGACCAAAGT TCCATCTACT
GAAACGGCGT GGACAACAGT CAAAACCTGG AACACAGAAA ACACCACTGC AACTTTCCCC TTTTTGTGAA TGAGACACAT
TATTAGTCCT TTTTTCAGCC AGACATGCTT TGGGCCAGAT GATGTCCTAG CATGAAATGT ACAACATTTT TTTTGGGCCG
GGCCGTTCTA CAGCTAATTA ACGAACGCTT TGGATGTGTG ACGCTGTGCA GAACCGGTGC GTGAACATGA TCGCGCACCT
GTTCCACGCG CCGCTCGGGG AGGACGAGAC GGCGGTGGGC GTGGGCACGG TGGGTTCGTC GGAGGCCATC ATGCTGGCCG
GGCTGGCCTT CAAGCGGCGG TGGCAGAACA AGCGCAAGGC CGAGGGGAAG CCGTTCGACA AGCCCAACAT CATCACCGGC
GCCAACGTGC AGGTGTGCTG GGAGAAGTTC GCCCGCTACT TCGAGGTGGA GCTCAAGGAG GTGAAGCTCC GCGACGGCTA
CTACGTCATG GACCCCGAGA AGGCCGTCGA CATGGTCAAC GAGAACACCA TCTGCGTCGC CGCCATCCTC GGCTCCACCC
TCAACGGCGA GTTCGAGGAC GTCAAGCTAC TCAACGACCT CCTCGACAAG AAGAACAAGG AGACTGGGTA ACTAAAATTA
CTATTTCTAC TACACTAAAT TATCTATCTA TGAAAGTGAG ATTAATCGAT GTCATTGCGG CCGTGGTGTG CAGGTGGGAG
ACGCCGATCC ACGTGGACGC GGCGAGCGGC GGGTTCATCG CGCCGTTCCT GTACCCGGAG CTGGAGTGGG ACTTCCGGCT
GCCGTGGGTG AAGAGCATCA ACGTGAGCGG TCACAAGTAC GGGCTCGTCT ACGCCGGCAT CGGCTGGTGC ATCTGGCGCA
ACAAGGAGGA CCTGCCCGAG GAGCTCATCT TCCACATCAA CTACCTCGGC ACCGACCAGC CAACCTTCAC CCTCAACTTC
TCCAAGGGCT CCAGCCAGGT CATCGCCCAG TACTACCAGC TCATCCGCCA CGGCTTCGAG GTATAATCAA TGGAACACAA
TTAACTCTCT TGATCAGATG AATTTTTTTT AGCTGATCTG ACACACCCAT CGATCCGATG TTATTTGCAG GGGTACAGGA
ACATCATGGA GAACTGCCAC GAGAACGCGA TGGTGCTGAA GGAAGGGCTG GTGAAGACGG GGAGGTTCGA CATCGTGTCC
AAGGACGAAG GGGTGCCGCT GGTGGCGTTC TCGCTCAAGG ACCGGAGCCG GCACGACGAG TTCGAGATCT CCGACATGCT
GCGCCGCTTC GGCTGGATCG TGCCGGCGTA CACCATGCCG CCCGACGCCC AGCACGTCAC GGTGCTCCGC GTGGTCATCC
GGGAGGAGTT CAGCCGCACC CTCGCCGAGC GCCTCGTCCT CGACATCGAG AAGGTGATGT ACCAGCTCGA CGCGCTCCCC
TCCAGGCTCA TGCCCCCCGT GCCGCCGGCG CCGCTGCTGG TGGTCGCCAA GAAGTCGGAG CTCGAGACGC AGCGGTCGGT
GACGGAGGCG TGGAAGAAGT TCGTGCTCGC CAAGAGGACC AACGGCGTCT GCTAGTCTCA ATTAGCGACA GCGCCACGGC
CTACAAATCC ACAAATCAAG ACGCTGCTGA TTGATATGAT TAATTACATT CATGGTGTGA GCTACCATTA CTGTATTTTT
TTTTTACCGT GCTAATTTGA GTGGAGCCTT CGATTCTAGG TCCAAGGTAC TAGTAGAGTT CATAACCAAA AGCCATGCTC
TTGCTTTTGT TTCTCCTTCT GATAATCTGT GCAGCTGCGC TGCAGCCTGC ACTCATCTCC CGAGAGTTGT AAGTTGAAAC
TGTACGATTT TGATGTTCCC TGTTCTAGTG TAAGTGCCAA TTATTGAGTG GTATGGAAAA TATTTCTTCA AGAAACC