Os03t0283200-00

Locus

Os03g0283200

Description

Similar to IN2-1 protein.

Transcript Evidence

AF237487 (DDBJ, Best hit)

Protein Evidence

NP_001105433.1 (RefSeq)

CGSNL Gene Symbol

GSTL1

CGSNL Gene Name

LAMBDA GLUTATHIONE S-TRANSFERASE 1

CGSNL Gene Symbol Synonym(s)

OsGSTL1

CGSNL Gene Name Synonym(s)

lambda class glutathione S-transferase 1, glutathione S-transferase lambda 1

Literature (PMID)

Manual Curation

Note

GO

Molecular Function: protein binding (GO:0005515)

InterPro

Glutathione S-transferase, N-terminal (IPR004045)

Glutathione S-transferase, C-terminal-like (IPR010987)

Thioredoxin-like fold (IPR012336)

Glutathione S-transferase/chloride channel, C-terminal (IPR017933)

KEGG

Os03t0283200-00 (EC:2.5.1.18)

RiceXPro Database

AF237487

Oryzabase

9459

Plant Gene Family Database (PGFD)

Os03t0283200-00

Transcript

1045 bp

>Os03t0283200-00 Similar to IN2-1 protein.
ATCACTCCTCCCTCTCCCAGCTCATCGCCATGGCCGCAGCTGCAGCACCGCGTAGCTCCG
GGAAAGAAGCGCTTCCCGCTGCGCTCGGCTCCGCCTCTGAGCCCCCTCGCCTCTTCGACG
GCACCACCAGGCTTTACATTTGCTACTTCTGCCCGTTTGCTCAGCGCGCTTGGATTATCA
GGAACTTCAAGGGCTTGCAGGACAAGATCGAGCTAGTCGGCATTGATCTGCAGGACAAAC
CAGCTTGGTACAAAGAGAAGGTTTACGAACAGGGCACGGTGCCTTCTCTAGAGCACAACG
GCAAGATCATGGGGGAGAGTTTAGATTTGATCAAGTACATCGACAGCCATTTCGAAGGCC
CTGCACTGCTCCCTGAAGATCCTGAGAAGAGACAGTTTGCTGATGAGCTTATTGCGTATG
CCAATGCGTTTACCAAAGCACTCTACTCACCCTTAATCTCCAAAGCAGATTTGTCAGCTG
AGACGGTTGCTGCTCTGGACAAGATAGAAGCTGCCCTGTCGAAGTTCGGTGATGGTCCAT
TCTTCCTTGGACAATTTAGCTTGGTGGACATTGCGTATGTGACAATTATTGAAAGGATTC
AGATATACTACTCTCATATAAGGAAATACGAGATCACCAATGGCCGGCCCAACCTCGAGA
AATTCATCGAGGAAATCAACAGAATCGAAGCATATACACAAACAAAAAATGACCCGCTTT
ACTTGCTCGATCTTGCGAAGACGCATCTTAAGGTTGCCTGAAGATGTTGAGCCAGCGATG
TACTGAATGACAGAATGATGATGATCCATGCCCCGCCCCCCCCCCCCCCCCCCCACACAC
ACACACAAAAAATCAATACTCTTTTCTTGCTACTCCAGTTGATAGTACATGTTTTGCAGC
TTTTGCTTCCAATAAACCGAAGTTGACATGTGGTGTAAAAGTCATGTTTGAGTAATAAAA
TACTGGTGTAATTCTATGTTACTCAATGTCGTTGGTCTTAAATATACTTTCATGTCATTG
AAAATAATCTTTTGTTGTCAAACTT

CDS

732 bp

>Os03t0283200-00 Similar to IN2-1 protein.
ATGGCCGCAGCTGCAGCACCGCGTAGCTCCGGGAAAGAAGCGCTTCCCGCTGCGCTCGGC
TCCGCCTCTGAGCCCCCTCGCCTCTTCGACGGCACCACCAGGCTTTACATTTGCTACTTC
TGCCCGTTTGCTCAGCGCGCTTGGATTATCAGGAACTTCAAGGGCTTGCAGGACAAGATC
GAGCTAGTCGGCATTGATCTGCAGGACAAACCAGCTTGGTACAAAGAGAAGGTTTACGAA
CAGGGCACGGTGCCTTCTCTAGAGCACAACGGCAAGATCATGGGGGAGAGTTTAGATTTG
ATCAAGTACATCGACAGCCATTTCGAAGGCCCTGCACTGCTCCCTGAAGATCCTGAGAAG
AGACAGTTTGCTGATGAGCTTATTGCGTATGCCAATGCGTTTACCAAAGCACTCTACTCA
CCCTTAATCTCCAAAGCAGATTTGTCAGCTGAGACGGTTGCTGCTCTGGACAAGATAGAA
GCTGCCCTGTCGAAGTTCGGTGATGGTCCATTCTTCCTTGGACAATTTAGCTTGGTGGAC
ATTGCGTATGTGACAATTATTGAAAGGATTCAGATATACTACTCTCATATAAGGAAATAC
GAGATCACCAATGGCCGGCCCAACCTCGAGAAATTCATCGAGGAAATCAACAGAATCGAA
GCATATACACAAACAAAAAATGACCCGCTTTACTTGCTCGATCTTGCGAAGACGCATCTT
AAGGTTGCCTGA

Protein

244 aa

>Os03t0283200-00 Similar to IN2-1 protein.
MAAAAAPRSSGKEALPAALGSASEPPRLFDGTTRLYICYFCPFAQRAWIIRNFKGLQDKI
ELVGIDLQDKPAWYKEKVYEQGTVPSLEHNGKIMGESLDLIKYIDSHFEGPALLPEDPEK
RQFADELIAYANAFTKALYSPLISKADLSAETVAALDKIEAALSKFGDGPFFLGQFSLVD
IAYVTIIERIQIYYSHIRKYEITNGRPNLEKFIEEINRIEAYTQTKNDPLYLLDLAKTHL
KVA*

5'UTR

chr03:9719856..9719884 (- strand) : 29 bp

CDS

chr03:9719830..9719855 (- strand) : 26 bp

chr03:9719633..9719707 (- strand) : 75 bp

chr03:9719464..9719524 (- strand) : 61 bp

chr03:9719262..9719348 (- strand) : 87 bp

chr03:9719056..9719154 (- strand) : 99 bp

chr03:9718785..9718893 (- strand) : 109 bp

chr03:9718409..9718485 (- strand) : 77 bp

chr03:9717638..9717827 (- strand) : 190 bp

chr03:9717537..9717544 (- strand) : 8 bp

3'UTR

chr03:9717253..9717536 (- strand) : 284 bp

FASTA

>Os03t0283200-00 class=Sequence position=chr03:9717253..9719884 (- strand)
ATCACTCCTC CCTCTCCCAG CTCATCGCCA TGGCCGCAGC TGCAGCACCG CGTAGGTAAG CCATCATTTG ATTAGTAGTA
GTGCTGTGAA CCAACTACTG ATTAGCTACG GAAAATGGCA AAGTTTTTAC CCTAATGACG ATCTCTGTGA TTAATTACGG
CTTCGCGTGT GATGCAGCTC CGGGAAAGAA GCGCTTCCCG CTGCGCTCGG CTCCGCCTCT GAGCCCCCTC GCCTCTTCGA
CGGCACCACC AGGTGAGGTT AACTTACGTG ACAGATAATT AATTACCATG CCTCTAAATC CCTTTTTTTT TCTTTTAACT
TCTGCGTCGA AGTAAATCTT CTTTTGTGAC TCTTGTGAAG GCTTTACATT TGCTACTTCT GCCCGTTTGC TCAGCGCGCT
TGGATTATCA GGAACTTCAA GGTGTTTGTT TCTGAACTTC TCTGACCTTT GGCTGCAGAG TTTCATACTC CTTTTACTCC
TCCTGCTAAA AACCTGAATT TTTTTTGTAC TTTTTTTTGG CTGTCAATTT GGCCAGGGCT TGCAGGACAA GATCGAGCTA
GTCGGCATTG ATCTGCAGGA CAAACCAGCT TGGTACAAAG AGAAGGTTTA CGAACAGGGC ACGGTACAGT ACACCTGTTC
TTCCTTCCTG CATGTCATCT GAATCTCTTC ATGTATAATT TTTGTCGATG AACAATTGAG TAGTATGGAT GTTGTTGTCT
TTCTCGATAG GTGCCTTCTC TAGAGCACAA CGGCAAGATC ATGGGGGAGA GTTTAGATTT GATCAAGTAC ATCGACAGCC
ATTTCGAAGG CCCTGCACTG CTCCCTGAAG TAAGGCAGAG AAATTCAGTG TAACACGTGA CAGTGATGCA GTTTTTTTAG
GGAGTGACAA TGATGCAGTT TTCTTTTTTT GGGAGTGACA ATGATGCAGT TTTTTTTTCT CTGAGACGTG GTTTACAGCT
TATAATAATG TTTGGATCTG GAAAATGACA GGATCCTGAG AAGAGACAGT TTGCTGATGA GCTTATTGCG TATGCCAATG
CGTTTACCAA AGCACTCTAC TCACCCTTAA TCTCCAAAGC AGATTTGTCA GCTGAGACGG GTAAGAGCta ctccctccgt
tccacaatat aagtcattct aacatttctc atattcatat tgatgctaat gaatctaaac atatatatct atctaaattc
attagcatca atatgaatat ggaaaatact agaatgactt atactgtgga acggaggaag taGTTGTGTC AATCTAGCAT
TGCAGCATCT ATGCCATGTT TGTAGATAAG GAGATTTGCA GTTTTAATTC ATTTGCATGC TGTTCGAGAA AATTCATTTG
CATACATGCT GATTTACTGA AATTATGTAT CATCATCAGT TGCTGCTCTG GACAAGATAG AAGCTGCCCT GTCGAAGTTC
GGTGATGGTC CATTCTTCCT TGGACAATTT AGCTTGGTAT GTCGATTCGG TTTGTTACAA TGTGGTTCAT TTTCCTTTCC
AATGTTTAGG ATGTGTCGAA GGTAAGggtt gggaacttct ttcccgcgta cataaaacgg agtaattcat tagcgcataa
gtaattaagt actccctccg gttctataat tcttcatgtt ttagacaact atacggtctc caaatatatc tttcactatg
ttttttatta taatatgtaa attaaataaa taaaatttta cttttattat agtactttgt aggtaaatct attgctctag
tgactttaac taaatatctt taaagttatt gatagtcaaa ggtatataaa acattgttca aaatgtcaag agtaataaaa
tcggagagag taTTAGctaa aaatacttga aaaatgaatc aatatgattt ttgatttttt aagtaacttt cgacatattt
tttttaagaa aaaacaatgc atcctttagt ggctcggaag gtgtgcggaa aaaaaaacAG AGAGTAGAAG TTGAAACTCC
TACGGAGCAC ACCCTTAATT TCTCCTAAAA AACTTGTGGC CATTCTTCGA TTTCCAGGTG GACATTGCGT ATGTGACAAT
TATTGAAAGG ATTCAGATAT ACTACTCTCA TATAAGGAAA TACGAGATCA CCAATGGCCG GCCCAACCTC GAGAAATTCA
TCGAGGAAAT CAACAGAATC GAAGCATATA CACAAACAAA AAATGACCCG CTTTACTTGC TCGATCTTGC GAAGACGCAT
CTTAAGGCAA GACCACTTCC TGAAACAAAT GCTCAGCCTC CGCAACTTTG ATCTGCCAGT TTTATAGTCA CTTGACAATT
GCACTTCTTT AATTTCCAGG TTGCCTGAAG ATGTTGAGCC AGCGATGTAC TGAATGACAG AATGATGATG ATCCATGCCC
CGCCCCCCCC CCCCCCCCCC CACACACACA CACAAAAAAT CAATACTCTT TTCTTGCTAC TCCAGTTGAT AGTACATGTT
TTGCAGCTTT TGCTTCCAAT AAACCGAAGT TGACATGTGG TGTAAAAGTC ATGTTTGAGT AATAAAATAC TGGTGTAATT
CTATGTTACT CAATGTCGTT GGTCTTAAAT ATACTTTCAT GTCATTGAAA ATAATCTTTT GTTGTCAAAC TT