Os03t0720300-01

Locus

Os03g0720300

Description

Similar to Glutamate decarboxylase isozyme 1 (EC 4.1.1.15).

Transcript Evidence

AK101171 (DDBJ, Best hit)

Protein Evidence

B4F972 (UniProt)

CGSNL Gene Symbol

CGSNL Gene Name

CGSNL Gene Symbol Synonym(s)

CGSNL Gene Name Synonym(s)

Literature (PMID)

Manual Curation

Note

GO

Biological Process: glutamate metabolic process (GO:0006536)

Biological Process: carboxylic acid metabolic process (GO:0019752)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: glutamate decarboxylase activity (GO:0004351)

Molecular Function: carboxy-lyase activity (GO:0016831)

Molecular Function: pyridoxal phosphate binding (GO:0030170)

InterPro

Pyridoxal phosphate-dependent decarboxylase (IPR002129)

Glutamate decarboxylase (IPR010107)

Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (IPR015421)

Pyridoxal phosphate-dependent transferase, major domain (IPR015424)

KEGG

Os03t0720300-01 (EC:4.1.1.15)

KOME

J033028M11 (Online Clone Ordering)

RiceXPro Database

AK101171

Plant Gene Family Database (PGFD)

Os03t0720300-01

Transcript

2064 bp

>Os03t0720300-01 Similar to Glutamate decarboxylase isozyme 1 (EC 4.1.1.15).
AAGGAGAGAGCCTTCCCGTCTCCTTTTTTTCCTTCCATCCAAAAAATTCCAAATGGAGTA
GTAGTTCACATTTTTACACCGTCGTCTTCGCAAATTTAATACTACTATACGAAGGAGGAG
GAAGCTCTCGCGCCGCGGTCGCTTTCCTTCCCCTAAATTAAATCCCGTGCGACGCGTAGA
GACCTCCTCCTCCGCTTTCTCCTCCAAAGCCCAAGCTAATCCCCCTCCTCTTCCTCGTCG
CCGGCGAGAGCTCTTCGTCTTCTCCAACTCGACCGGAAGCAAGCGCGCTTCCGATCCGCC
ATGGTGCTCTCCCACGGCGTGTCGGGCTCCGATGAGTCCGTccactccacgttcgcctcc
cgctacgtccgcacctccctcccCAGGTTCCGGATGCCGGAGCAGTCGATCCCCAAGGAG
GCGGCGTACCAGATCATCAACGACGAGCTGATGCTGGACGGCAACCCGCGGCTGAACCTC
GCGTCGTTCGTCACCACGTGGATGGAGCCCGAGTGCGACAAGCTCATCCAGGCCTCCGTC
AACAAGAACTACGTCGACATGGACGAGTACCCCGTCACCACCGAACTCCAGAACCGATGT
GTGAACATGATTGCACACCTCTTCAATGCTCCTCTAGGGGACTCTGAAACGGCCGTCGGA
GTCGGCACTGTCGGCTCGTCTGAGGCCATCATGCTCGCCGGTTTGGCCTTCAAGAGGAGG
TGGCAGAACAAGATGAAGGCAGCCGGCAAGCCATGCGACAAGCCTAACATTGTCACCGGC
GCCAATGTCCAAGTTTGCTGGGAGAAGTTCGCGCGATACTTCGAGGTTGAGCTCAAGGAA
GTGAAGCTGAGTGACGGCTACTACGTCATGGACCCAGCTAAGGCCGTGGATATGGTCGAC
GAGAACACCATCTGCGTCGCGGCGATCCTCGGGTCGACGCTGAACGGGGAGTTCGAGGAC
GTGAAGCTGCTCAACGATCTGCTCACCAAGAAGAACGCTGAAACAGGCTGGGACACGCCG
ATCCACGTGGACGCGGCGAGCGGCGGGTTCATCGCGCCGTTCCTGTACCCGGAGCTGGAG
TGGGACTTCCGGCTGCCGCTGGTGAAGAGCATCAACGTGAGCGGGCACAAGTACGGCCTC
GTCTACGCCGGGATCGGGTGGTGCATCTGGAGGAGCAAGGAGGATCTGCCTGAGGAGCTC
ATCTTCCACATCAACTACCTCGGCGCCGACCAGCCCACCTTCACCCTCAACTTCTCCAAG
GGTTCCAGCCAGGTCATTGCACAGTATTACCAACTAATCCGCCTAGGCTTTGAGGGGTAC
AAGAACATCATGGAGAACTGCCAGGAGAACGCGATGGTGCTGAAGCAGGGGCTGGAGAAG
ACGGGGCGGTTCAACATCGTGTCCAAGGACAACGGCGTGCCGCTGGTGGCCTTCTCCCTC
AAGGACAGCGCCCGGCACAACGAGTTCGAGATCTCCGACTTCCTCCGCCGCTTCGGCTGG
ATCGTGCCGGCCTACACCATGCCCCCCGACGCGCAGCACGTCACCGTGCTCCGCGTCGTC
ATCCGCGAGGACTTCAGCCGCACGCTCGCCGAGCGCCTCGTGCTCGACGTCGAGAAGGTG
CTGCACGAGCTCGACGCGCTCCCCGCCCGCGTCGTCGCCAACGGCGGCGACGCCGCCGCC
GCGTCGGCGAGCGAGAGGGAGATGGAGAAGCAGCGCGAGGTGATCTCCCTCTGGAAGAGG
GCCGTGCTGGCCAAGAAGAAGACCAACGGCGTCTGCTAAAGCAAGTCAGCTGCGCAGCGG
GGATCGTATACTATTATTATGGTCCACTTCGTAATTGCGACTTCTTAATTTTTACCGTGT
CGATCGGTTTACCGTCTCAAGTCTGCTCTCATCCGATTTTCGGATTGATGCTGCTTAATT
ATGTACCAAGTTAATTAATTCTTAGAGGACGGAATAGTTCCGACTCAATACGAAGCATTG
CCTGTATAAGTCGAACACGGGATCATGCATTTTACGTTGGGTGTGTAGCAGTGAATTGAT
CAGTGATGCTCCATCTCTACTCTG

CDS

1479 bp

>Os03t0720300-01 Similar to Glutamate decarboxylase isozyme 1 (EC 4.1.1.15).
ATGGTGCTCTCCCACGGCGTGTCGGGCTCCGATGAGTCCGTccactccacgttcgcctcc
cgctacgtccgcacctccctcccCAGGTTCCGGATGCCGGAGCAGTCGATCCCCAAGGAG
GCGGCGTACCAGATCATCAACGACGAGCTGATGCTGGACGGCAACCCGCGGCTGAACCTC
GCGTCGTTCGTCACCACGTGGATGGAGCCCGAGTGCGACAAGCTCATCCAGGCCTCCGTC
AACAAGAACTACGTCGACATGGACGAGTACCCCGTCACCACCGAACTCCAGAACCGATGT
GTGAACATGATTGCACACCTCTTCAATGCTCCTCTAGGGGACTCTGAAACGGCCGTCGGA
GTCGGCACTGTCGGCTCGTCTGAGGCCATCATGCTCGCCGGTTTGGCCTTCAAGAGGAGG
TGGCAGAACAAGATGAAGGCAGCCGGCAAGCCATGCGACAAGCCTAACATTGTCACCGGC
GCCAATGTCCAAGTTTGCTGGGAGAAGTTCGCGCGATACTTCGAGGTTGAGCTCAAGGAA
GTGAAGCTGAGTGACGGCTACTACGTCATGGACCCAGCTAAGGCCGTGGATATGGTCGAC
GAGAACACCATCTGCGTCGCGGCGATCCTCGGGTCGACGCTGAACGGGGAGTTCGAGGAC
GTGAAGCTGCTCAACGATCTGCTCACCAAGAAGAACGCTGAAACAGGCTGGGACACGCCG
ATCCACGTGGACGCGGCGAGCGGCGGGTTCATCGCGCCGTTCCTGTACCCGGAGCTGGAG
TGGGACTTCCGGCTGCCGCTGGTGAAGAGCATCAACGTGAGCGGGCACAAGTACGGCCTC
GTCTACGCCGGGATCGGGTGGTGCATCTGGAGGAGCAAGGAGGATCTGCCTGAGGAGCTC
ATCTTCCACATCAACTACCTCGGCGCCGACCAGCCCACCTTCACCCTCAACTTCTCCAAG
GGTTCCAGCCAGGTCATTGCACAGTATTACCAACTAATCCGCCTAGGCTTTGAGGGGTAC
AAGAACATCATGGAGAACTGCCAGGAGAACGCGATGGTGCTGAAGCAGGGGCTGGAGAAG
ACGGGGCGGTTCAACATCGTGTCCAAGGACAACGGCGTGCCGCTGGTGGCCTTCTCCCTC
AAGGACAGCGCCCGGCACAACGAGTTCGAGATCTCCGACTTCCTCCGCCGCTTCGGCTGG
ATCGTGCCGGCCTACACCATGCCCCCCGACGCGCAGCACGTCACCGTGCTCCGCGTCGTC
ATCCGCGAGGACTTCAGCCGCACGCTCGCCGAGCGCCTCGTGCTCGACGTCGAGAAGGTG
CTGCACGAGCTCGACGCGCTCCCCGCCCGCGTCGTCGCCAACGGCGGCGACGCCGCCGCC
GCGTCGGCGAGCGAGAGGGAGATGGAGAAGCAGCGCGAGGTGATCTCCCTCTGGAAGAGG
GCCGTGCTGGCCAAGAAGAAGACCAACGGCGTCTGCTAA

Protein

493 aa

>Os03t0720300-01 Similar to Glutamate decarboxylase isozyme 1 (EC 4.1.1.15).
MVLSHGVSGSDESVHSTFASRYVRTSLPRFRMPEQSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIQASVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRRWQNKMKAAGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSDGYYVMDPAKAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLTKKNAETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWCIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYKNIMENCQENAMVLKQGLEK
TGRFNIVSKDNGVPLVAFSLKDSARHNEFEISDFLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVLDVEKVLHELDALPARVVANGGDAAAASASEREMEKQREVISLWKR
AVLAKKKTNGVC*

5'UTR

chr03:29200210..29200509 (+ strand) : 300 bp

CDS

chr03:29200510..29200592 (+ strand) : 83 bp

chr03:29200688..29200895 (+ strand) : 208 bp

chr03:29206436..29206636 (+ strand) : 201 bp

chr03:29206710..29206924 (+ strand) : 215 bp

chr03:29207074..29207327 (+ strand) : 254 bp

chr03:29207459..29207511 (+ strand) : 53 bp

chr03:29207881..29208345 (+ strand) : 465 bp

3'UTR

chr03:29208346..29208630 (+ strand) : 285 bp

FASTA

>Os03t0720300-01 class=Sequence position=chr03:29200210..29208630 (+ strand)
AAGGAGAGAG CCTTCCCGTC TCCTTTTTTT CCTTCCATCC AAAAAATTCC AAATGGAGTA GTAGTTCACA TTTTTACACC
GTCGTCTTCG CAAATTTAAT ACTACTATAC GAAGGAGGAG GAAGCTCTCG CGCCGCGGTC GCTTTCCTTC CCCTAAATTA
AATCCCGTGC GACGCGTAGA GACCTCCTCC TCCGCTTTCT CCTCCAAAGC CCAAGCTAAT CCCCCTCCTC TTCCTCGTCG
CCGGCGAGAG CTCTTCGTCT TCTCCAACTC GACCGGAAGC AAGCGCGCTT CCGATCCGCC ATGGTGCTCT CCCACGGCGT
GTCGGGCTCC GATGAGTCCG Tccactccac gttcgcctcc cgctacgtcc gcacctccct ccccaggcac gcacgctcgc
ctcTGTCTCG AGCGCCATTG GCGCCGATCG ATTCGGTGAT TGATTGGGAG TTTTAATTTT GGATCCGGGC GGGGCTTGCA
GGTTCCGGAT GCCGGAGCAG TCGATCCCCA AGGAGGCGGC GTACCAGATC ATCAACGACG AGCTGATGCT GGACGGCAAC
CCGCGGCTGA ACCTCGCGTC GTTCGTCACC ACGTGGATGG AGCCCGAGTG CGACAAGCTC ATCCAGGCCT CCGTCAACAA
GAACTACGTC GACATGGACG AGTACCCCGT CACCACCGAA CTCCAGGTAC TCCTCCCCCC CACCTTGCTT TTCCGCCGCC
GCGGCCGCCA CCCCCCTCCC TCCTCATCCC GTTCGTCGTT TCGCGTTCGT TATTACGCCG CAAATTCAGG GATCACTGCG
GTTATTAATC CCTCTCGTTT TACCGTGAGA TTTATCCCAA AATTTTGATC CAAACTTATT TTTGGTTTGA TTTGATTTGG
GTTTGGGTGG CGGCGTAGGG TAGCTGCTGG GTTTTGATCA GCTCGTTCCA ATGGGTGCAA CCGGCCAACC CAGTTGGTGG
CCGTCCGTTT CGACAAGTAG TCGCGGTGGA TTTCTAATCC TCCCACTTGG CCGCTGATCT GGTCTAGAGA TTAGAAAACT
AGCTACTTAG AAAAATGGAG TACAAACAGC TCGATTGTCC GCGTGAGCCA AGGGCCATCA GCCCATCACA TACTCACATG
CGCCTTCGCC CATTGGCTCT CTCTTGACTA CAATAATATG GATCCTTGTT TACCTTCTCT CAGACTGTAC GTTTCTGCTT
TTCCGTTTTT AAAACGAAAG TTGCCAAGAA CTCGGGGAAT CGTAACTCAT ATGCAGCCAT TTTTCGCCAG TATTTAGGCT
GTGTTCTTCC CATGAGTTTT CAACTCATGG AAACTCATCT CCCCGTTTGA TACGGGtttc aaaaaagttt atataagaaa
attgttttaa aaaatcatat taattaatta ttcaagtttt ttattactaa tacttaatta atcacatgtt aatTTACCCC
TCCAAAAGAA CATGTACACA GCCTTAGCAT GGATAGGTCG AGATGTTGAA GAATCCCTTT GTAATGCTTT TTTTTTACCA
AGTTACACGA AAAATAAAAT AACTTTAAAT TTTAATAATC CTATAGAATT CCTGCATCCG GCACAACCAA CATGTTCGTC
ATTAAGCAAA CAGTTTCGTT TGCCTGTGTT TTATAAGGGT GAGCGATAAA TTAAGCGATA CACAGTAGAC TTTTTGATTG
CTTTGGAGTG TTTGTAACCG TAGTCGTAAC GGCAAGAACA AGTAGGTCCC TTTGAAGCAA CTATATATGA CCCGATTGCC
AGGGTCAAAA ATGATGTGAC AGAAATGAAA AACCCATTCC CAGCGTGTCT GTCACCTTGA CGCGTACTCA CTACTGACAT
AAAAACAACG ATTAGTGTCT CTTTCAGTAG TTAATTAGGA CAGAAATTGA TTCACCGATT AAAGAAAAAC AGTACTCGTA
CATGTTCGAG GATCCCTCGT TCCTAGGAGG AGAATCGAAT TTGGTCGGTC CTGGACAAAT GTCACGTGGT GACTCTTGGT
TTCTGAGTGG ATTGGAAACA TAAAACATAA AACTCAGTTT CTAATTGGAC TAATTAGATC TGACACTACC TTATATTTAG
ATTTGTAGTA TTACTTGGTG TCTAATCATG TATTTGCTAT ATTTTGAGGT GAAATAAACA CATTGCCAGT ATTTTCATAT
GAGTTTTTGG TCATTTCAAT CTGCTGACCT GTCAAGAAAA AAAATGTTTT TCTTCTAAAT TTTATCCTTC AAAATGGAAC
ATATTCTATG AATTTTCCGC CCTCCAAGTG AGAAGATAAT AATTGTAGTA ATTAAGCCAA TGTCCGGTGA TTACGTCTTA
TGTGTGGACA GATGCAAAAT TTTCGCTGCC GACGTACTCT CTGTGTCCAC CAATAATTCC TTGACAATAT GTCCCCTGTC
CTCTCATTTT CTTTGAGGCT AACGGGCGGG TGATCAACCC GCCCCTCCCT CTGTACTCCT CTCCCTTCTT TCCTATCATC
GTAAAATAAA AAAAACCACA AAATTAGTAA AAAAATTAGA AAAAAAATCT AATACTCTTA TACATGTGCA taaactttat
accgtaaact ttgcacacat aaacttactt tatgtataga aatattttat atatacaaat atttgaatct gaatttaaat
ttaaatcggg tatataaact tttgacttat aaacattcgc tctacaaact ttaggtggat aaactttaga tgtgtaaact
ttaggtgtat aaacttttga cttataaaca ttcgctttac aaactttagg tggataaact atagatatgt aaactttagt
tgtataaact taTTAGAAGA GAAAAAGAAA AAAAACGATG GCTGGCAGCG ATTGATCGCT CATTAGGAAA ACCGTGGGAT
ATTGTCTATT GTCAAGGCCT AGTGGGATTT GCCTTTCTCT GTCCACTAAG CAGCCCCGTA GAAGAAGGGT AACGGAACGA
GGCGGTCGTC GGTTTTCTGA CGGAATTCAT GTGCTAACGA CCAACCAAAT GTCAAGCCAT AACAAGCTGT GGAATGGGGA
TGGAAACAAT GAGTTCAAGT TGTATTCTGG GTCCATAATA ATTGTCCTTT TGCGATATTG TGTCACGTAG CTGCTCTTAG
CCATGTGAGG GGTTAGGTCG TGATGTATTC TGAAAATGTT TCTTTTCATG GTAAACCAGA AGAAAGTCGA GAACTAATTT
CGTTACATGG TGGGGGTACA TGATAAAGCT GTTATCTTGC GCTCCAATAA TATACACACG CACGTAAGAG CCACGTAAAC
CATTCATGTC CTTTTCCCCT GTTTATTTTA GTCACAGATT TTCCGAGGAT GAAAAAAGAA ACTGTACTAG TTTCAGTTTT
GTTGATTCAA GATCACTGTT TAACTTTCAA GTAACCGAAA TCTCTTCAAA TTTCAATGGT GGGGTTATAA GTTAAAACGG
TCTGAGAGAG TGTGCTGAAG GACGGAACAA CCTGGCCAGT GCTAATCACT TGGTCTGTAG TACTCCATCG GTTGGGATGA
GCCCTCTAAC AGATATTGCA TCTGTTTTGT TATATGGTTC TATCGGATGA CCGAGAGTTG ATTATACCCC GTAACAGTTT
ATtactacct ccgtttcaca atgtaaaact ttctagcatt gcccatattc atttagatgt taaatgaatc tagacttatg
tatgtgttta gattcattaa catctatatg tatgtcggca atgctagaaa gtcttacatt gtgaaacgga gggagtaGTA
ACttaaaaat taactagctg ggtggccggc gcaattgcgc ggctagcacc caaacaaaat catatatatt tttagtatga
ttttacttaa aatgtattaa atagctattt cattgtctta agactttgaa agatcaaacc ctatctcctc gtgtttctaa
ttatatagtt ttaaaagtca caccaattac tatccctcat gtcatctctt tctttatttg cttgctcaat ctaccactat
ttctattcat tcttcttgga atatttaaaa attggatttt atagttttta aagtttattg tcacgttgga tttcattttt
ataatttcta gatatcccgt caaacgttgc cattatactc ctctacggcc cgtccactgt ctcttctctt tattgtcatt
gagattttaa aaatcgaaca taattatcgt ttggtttcat ttttactttc tagaagtccc gccaaaccgt cagtggcttt
gcgattgtac tcctctacgg ctcgcccgct gcctcccttc tttattgtca ttgagatttt aaaatcgaac atgattatca
ttgttttttt tacttttcag aagttccgat cctttaaaaa ttggacttgt agtttcattt ttaataattt taaaaagtcc
catcaaacga tgccactatg cccctctata gcctgtccgc cgcctactct ttattgtcat tgtgattcta aaaatcgaac
atcatgatat cgtgggaatt tattttttat ttttcatttg gtgttttatt aacaattttt atacgtcgta tcaaccgcca
ccactctact catttatagg tctgttactt aatttatctc gtcatgtgtt ttagatgatc ttttctttca ataatcttta
ttttttatca aaaaatttag tcctaattga aatattattt ttctttttct aatttcagat ttttttaaaa attttagtta
ataccgtatt gtgttctttt aatgttttta ttttttattt ttaatttcag ttgtttcaaa attgtattcc tacttgaact
ctcttttatt ttttctaatt ttggatatta ttttattttt attctaaatt ttaattaatc tcgtactgcg ttcttatatg
gattcttctt tcagtattgc ttatttctaa ttccgaattt cagcaaattt taaattgtat tcctacttga actcttcttt
tattttcttt tgctaatttc ggatttattt atttttaTTC CGAATTTTAa taatctcgta ttgggttctt atatagactc
ttcttttaat attctttttt tttaattccg aatttcagct atttttaaat tgtattccta cttggactct catttccttt
tctaattttg gtttttattt tgaaatttta ttaatctcgt attgggttct tatatgaaaa cttatttcta tattgcttat
ttttaattcc gaatttcagc tatttttaaa tcgtatttct acttgggctc tccattcctt ttctaatttt gggttttatt
ttatttttat ttcaaatttt aattaatctc gtattgggtt cttatacgga aacttctttc aatattgctt atttttaatt
ccgaatttca gctattttta aattgtactt ctacttggac tcttcttttt tttttcttta tctccgatta atgtgggaat
ttctagctcc cacagcgaac gtggtgcctc ctttcaaagc tgttttaata atataacACA TAGATAGATA Gatagattgt
gggtaaaatc ttttatatat gtgtgtctag tgtcctaagc aatttataag ccaatgataa caaaattacg ttgtgaaaat
aaatcaactt taaaattaag ttaggaaatt taaatgttgg AGCATTCGCG TATATTGTTT GTCCACAGCT TTTCTAATTT
TCACTACTCA CTACGGTATA ATAATGGAAA TTAAGAATCC AAAACGTGCA TATTACTATC CATTTTTTGT TATAAGGTGC
CTTGATTTTT TTTCTAGTTA AATTTTGTTA GCGACTAGTG AAGTCAACTT GCACTATGTT GGAACATATC TTTTTTTGTA
GCAATTTTAT ATATAGATTT TTCTCTAGAC GTGGTTGGGA GCGCATATAC GTCAAATATC ATTCCACATT TCTTCAAGAG
TGATCAAACT TCACAAAGAT TGACAACAGC AATTTTAAGT CATAAAATAA AACAGAATGA AAACAATATT GAACATGGTT
ATGACAACAG TAACATTTCC TCTTATATGG CATCATTATG CTAGTTTCAT TAACATCTTC TCCACATTTA GTCAAACTGT
CAGAGTATTT ATGGCTCAAA ATTTGAATTT GAGTGAGTGA ATTACGTTGT AGCAAAATGT GTTTATTGAT GTAAATTCGT
AAACCATTGC TATAACTGCA TAGCTGGTGC TTCTTCTCAA CTTTCAACTG AATTTGCTGT TTGCAGAACC GATGTGTGAA
CATGATTGCA CACCTCTTCA ATGCTCCTCT AGGGGACTCT GAAACGGCCG TCGGAGTCGG CACTGTCGGC TCGTCTGAGG
CCATCATGCT CGCCGGTTTG GCCTTCAAGA GGAGGTGGCA GAACAAGATG AAGGCAGCCG GCAAGCCATG CGACAAGCCT
AACATTGTCA CCGGCGCCAA TGTCCAAGTA AGCAGATGGC CATCTCCATT TACCACTCTT GTTAACGAGC ACGCGTAATT
AACCCACATT TGAAATGCAG GTTTGCTGGG AGAAGTTCGC GCGATACTTC GAGGTTGAGC TCAAGGAAGT GAAGCTGAGT
GACGGCTACT ACGTCATGGA CCCAGCTAAG GCCGTGGATA TGGTCGACGA GAACACCATC TGCGTCGCGG CGATCCTCGG
GTCGACGCTG AACGGGGAGT TCGAGGACGT GAAGCTGCTC AACGATCTGC TCACCAAGAA GAACGCTGAA ACAGGGTAAC
GAATCAAACA GTTCATTTCT TCCAATCCTC TGCACAAAGC CACAAAGTAC TTATATGCCC CAATGCACAT TGAAAACTGA
AAAGTGTTTG CTGCATAGTA AAAAGCTAAT GCAGAGTTGC TGCTGGATTG ATTTGAATGT GCAGCTGGGA CACGCCGATC
CACGTGGACG CGGCGAGCGG CGGGTTCATC GCGCCGTTCC TGTACCCGGA GCTGGAGTGG GACTTCCGGC TGCCGCTGGT
GAAGAGCATC AACGTGAGCG GGCACAAGTA CGGCCTCGTC TACGCCGGGA TCGGGTGGTG CATCTGGAGG AGCAAGGAGG
ATCTGCCTGA GGAGCTCATC TTCCACATCA ACTACCTCGG CGCCGACCAG CCCACCTTCA CCCTCAACTT CTCCAAGGGT
AAAAATCTCC TCTCTTTGTT TTGACAGTTT TACGGTTTCT TGAATCTTGA TGGCTATGTC AGTTCGGTTC ATCTGGTTAC
ATGCATGATG CACGCACACA ATAACAGAAT GGCACAATCT TTTTTCCAGG TTCCAGCCAG GTCATTGCAC AGTATTACCA
ACTAATCCGC CTAGGCTTTG AGGTGAGAAA AATGCTATTT CTTAGTACTC TCTCTCCGTT TCAGGTTATA AGACGTTTTG
CTtttggtca aagtcaaact actttaaatt taactaagtt tatagacaaa taaagtaata cttataatat caaattagtt
tcattaaatc aataattgaa taaattttca taatatattt gtcttggtta aaaatatcac cacttttttt ctataaaatt
agttaaacta agattaattt gactttgacc aaaGTCACAA CATCTTATAA CCTAAAACGG AGGGAGTAGC TTTTATCACT
CTTACACAAT CACAATTAAC TTGTACTCCT ATGTGATTAA TACATATAAT TTGATCACGT GATATTTGCA GGGGTACAAG
AACATCATGG AGAACTGCCA GGAGAACGCG ATGGTGCTGA AGCAGGGGCT GGAGAAGACG GGGCGGTTCA ACATCGTGTC
CAAGGACAAC GGCGTGCCGC TGGTGGCCTT CTCCCTCAAG GACAGCGCCC GGCACAACGA GTTCGAGATC TCCGACTTCC
TCCGCCGCTT CGGCTGGATC GTGCCGGCCT ACACCATGCC CCCCGACGCG CAGCACGTCA CCGTGCTCCG CGTCGTCATC
CGCGAGGACT TCAGCCGCAC GCTCGCCGAG CGCCTCGTGC TCGACGTCGA GAAGGTGCTG CACGAGCTCG ACGCGCTCCC
CGCCCGCGTC GTCGCCAACG GCGGCGACGC CGCCGCCGCG TCGGCGAGCG AGAGGGAGAT GGAGAAGCAG CGCGAGGTGA
TCTCCCTCTG GAAGAGGGCC GTGCTGGCCA AGAAGAAGAC CAACGGCGTC TGCTAAAGCA AGTCAGCTGC GCAGCGGGGA
TCGTATACTA TTATTATGGT CCACTTCGTA ATTGCGACTT CTTAATTTTT ACCGTGTCGA TCGGTTTACC GTCTCAAGTC
TGCTCTCATC CGATTTTCGG ATTGATGCTG CTTAATTATG TACCAAGTTA ATTAATTCTT AGAGGACGGA ATAGTTCCGA
CTCAATACGA AGCATTGCCT GTATAAGTCG AACACGGGAT CATGCATTTT ACGTTGGGTG TGTAGCAGTG AATTGATCAG
TGATGCTCCA TCTCTACTCT G