Os04t0447400-01

Locus

Os04g0447400

Description

Similar to Glutamate decarboxylase 2 (EC 4.1.1.15) (GAD 2).

Transcript Evidence

AK070858 (DDBJ, Best hit)

Protein Evidence

Q01J85 (UniProt)

CGSNL Gene Symbol

CGSNL Gene Name

CGSNL Gene Symbol Synonym(s)

CGSNL Gene Name Synonym(s)

Literature (PMID)

Manual Curation

Note

GO

Biological Process: glutamate metabolic process (GO:0006536)

Biological Process: carboxylic acid metabolic process (GO:0019752)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: glutamate decarboxylase activity (GO:0004351)

Molecular Function: carboxy-lyase activity (GO:0016831)

Molecular Function: pyridoxal phosphate binding (GO:0030170)

InterPro

Pyridoxal phosphate-dependent decarboxylase (IPR002129)

Glutamate decarboxylase (IPR010107)

Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (IPR015421)

Pyridoxal phosphate-dependent transferase, major domain (IPR015424)

KEGG

Os04t0447400-01 (EC:4.1.1.15)

KOME

J023068K15 (Online Clone Ordering)

RiceXPro Database

AK070858

Plant Gene Family Database (PGFD)

Os04t0447400-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os04t0447400-01

Transcript

1917 bp

>Os04t0447400-01 Similar to Glutamate decarboxylase 2 (EC 4.1.1.15) (GAD 2).
CGCGTCGTCGTCCCCTCTCCTAGCTAGCGGCTATCAAACCCCCACACCACTGCTCGATCG
ATCGTCGCAGCCGGAGTAACTAAGGCAGAGATCAGATCAGGCGAATTAGGAGCATATGGC
GCTGTCGACGGCGCAGACAGGGGAGTCGATGCACTCCTCGACGTTCGCGTCGCGGTACGT
GCGCACGGCGCTGCCGAGGTTCAGGATGCCGGAGAAGTCGATCCCCAAGGACGCGGCGTA
CCAGATCATCAACGACGAGCTGATGCTCGACGGCAACCCGCGCCTGAACCTGGCGTCCTT
CGTCACCACGTGGATGGAGCCCGAGTGCGACAAGCTCATGATGGCCGCCATCAACAAGAA
CTACGTCGACATGGATGAGTACCCCGTCACCACCGAGCTCCAGAACCGGTGCGTGAACAT
GATCGCGCATCTGTTCAACGCGCCGATCGGGGACGACGAGACGGCGGTCGGGGTGGGCAC
GGTGGGGTCGTCGGAGGCCATCATGCTGGCGGGGCTGGCGTTCAAGAGGAAGTGGCAGAA
CAGGATGAAGGCCGAGGGGAAGCCCCACGACAAGCCCAACATCGTGACGGGGGCCAACGT
GCAGGTGTGCTGGGAGAAGTTCGCGCGCTACTTCGAGGTGGAGCTCAAGGAGGTGAAGCT
GACCCAAGGGTACTACGTGATGAACCCGGAGAAGGCCGTGGAGATGGTCGACGAGAACAC
CATCTGCGTCGCCGCCATCCTCGGCTCCACCCTCAACGGCGAGTTCGAGGACGTCAAGAT
GCTCAACGACCTCCTCACCGCCAAGAACGCCGAGACAGGGTGGAACACGCCGATCCATGT
GGACGCGGCGAGCGGCGGGTTCATCGCGCCGTTCATCTACCCGGAGCTGGAGTGGGACTT
CCGGCTGCCGCTGGTGAAGAGCATCAACGTCAGCGGCCACAAGTACGGGCTCGTCTACGC
CGGCGTCGGGTGGGTCATCTGGCGCAACAAGGAGGACCTCCCCGATGAGCTCATCTTCCA
CATCAACTACCTCGGCGCCGACCAGCCAACCTTCACGCTCAACTTCTCCAAAGGATCGAA
CCAGATAATTGCGCAGTATTACCAGCTCATTCGTCTCGGATTCGAGGGGTACAAGGACAT
CATGCAGAACTGCCGGGACAACGCGACGGTGCTCCGGGAGGGGATCGAGAAGACGGGCCA
CTTCGACGTGGTGTCCAAGGACTCCGGCGTGCCGCTGGTGGCCTTCTCCCTCAAGGACTC
GTCGCGGTACACGGTGTTCGAGGTGGCCGAGAGCCTCCGCCGCTTCGGCTGGATCGTGCC
GGCGTACACCATGCCCGCCGACGCTGAGCACGTCGCCGTGATGCGCGTCGTCATCCGCGA
GGACTTCAGCCGCGGCCTCGCCGAGCGCCTCATCACCGACCTCACCAAGACGGTGGCCGA
TATGGACGCCCACGCCGTCAAGAAGGCCGCCGCCGAGCCGGCCAAGAAGACCGTGCGGGA
GATAGAGAAGGAGGTGACCACCTACTGGCGGAGTTTCGTCGCCAGGAAGAAGAGCAGCCT
CGTCTGCTGATCATCGACTCCTGCACTCGCGCGTACATAAAGTGCAGGAACGAATAATTC
TTGACCCGTCTTGCATTGAGTTCTTCGTTTGCTGCTGCTTCTTTTCTTTTTTTTTTTCCT
TTTCACCCGCTGAATTTTGAGTTCAGTTTCAAATTCGCTTCGATAGATTTGTGTATGTCA
CACCGATTTGTGGCATTCTTGCAGACAAGTTACCAATATGAAATGCGTATAGGCATGTAC
ACGCAGAGACGTGTCAGGCAGAACAGAAGTGAGATGCACCGATCTGTACCGGCCATGGCA
TGGAATTGGTTTGTCATGGGCTATAGTTGGttgacagaataagttcattttgtgacc

CDS

1455 bp

>Os04t0447400-01 Similar to Glutamate decarboxylase 2 (EC 4.1.1.15) (GAD 2).
ATGGCGCTGTCGACGGCGCAGACAGGGGAGTCGATGCACTCCTCGACGTTCGCGTCGCGG
TACGTGCGCACGGCGCTGCCGAGGTTCAGGATGCCGGAGAAGTCGATCCCCAAGGACGCG
GCGTACCAGATCATCAACGACGAGCTGATGCTCGACGGCAACCCGCGCCTGAACCTGGCG
TCCTTCGTCACCACGTGGATGGAGCCCGAGTGCGACAAGCTCATGATGGCCGCCATCAAC
AAGAACTACGTCGACATGGATGAGTACCCCGTCACCACCGAGCTCCAGAACCGGTGCGTG
AACATGATCGCGCATCTGTTCAACGCGCCGATCGGGGACGACGAGACGGCGGTCGGGGTG
GGCACGGTGGGGTCGTCGGAGGCCATCATGCTGGCGGGGCTGGCGTTCAAGAGGAAGTGG
CAGAACAGGATGAAGGCCGAGGGGAAGCCCCACGACAAGCCCAACATCGTGACGGGGGCC
AACGTGCAGGTGTGCTGGGAGAAGTTCGCGCGCTACTTCGAGGTGGAGCTCAAGGAGGTG
AAGCTGACCCAAGGGTACTACGTGATGAACCCGGAGAAGGCCGTGGAGATGGTCGACGAG
AACACCATCTGCGTCGCCGCCATCCTCGGCTCCACCCTCAACGGCGAGTTCGAGGACGTC
AAGATGCTCAACGACCTCCTCACCGCCAAGAACGCCGAGACAGGGTGGAACACGCCGATC
CATGTGGACGCGGCGAGCGGCGGGTTCATCGCGCCGTTCATCTACCCGGAGCTGGAGTGG
GACTTCCGGCTGCCGCTGGTGAAGAGCATCAACGTCAGCGGCCACAAGTACGGGCTCGTC
TACGCCGGCGTCGGGTGGGTCATCTGGCGCAACAAGGAGGACCTCCCCGATGAGCTCATC
TTCCACATCAACTACCTCGGCGCCGACCAGCCAACCTTCACGCTCAACTTCTCCAAAGGA
TCGAACCAGATAATTGCGCAGTATTACCAGCTCATTCGTCTCGGATTCGAGGGGTACAAG
GACATCATGCAGAACTGCCGGGACAACGCGACGGTGCTCCGGGAGGGGATCGAGAAGACG
GGCCACTTCGACGTGGTGTCCAAGGACTCCGGCGTGCCGCTGGTGGCCTTCTCCCTCAAG
GACTCGTCGCGGTACACGGTGTTCGAGGTGGCCGAGAGCCTCCGCCGCTTCGGCTGGATC
GTGCCGGCGTACACCATGCCCGCCGACGCTGAGCACGTCGCCGTGATGCGCGTCGTCATC
CGCGAGGACTTCAGCCGCGGCCTCGCCGAGCGCCTCATCACCGACCTCACCAAGACGGTG
GCCGATATGGACGCCCACGCCGTCAAGAAGGCCGCCGCCGAGCCGGCCAAGAAGACCGTG
CGGGAGATAGAGAAGGAGGTGACCACCTACTGGCGGAGTTTCGTCGCCAGGAAGAAGAGC
AGCCTCGTCTGCTGA

Protein

485 aa

>Os04t0447400-01 Similar to Glutamate decarboxylase 2 (EC 4.1.1.15) (GAD 2).
MALSTAQTGESMHSSTFASRYVRTALPRFRMPEKSIPKDAAYQIINDELMLDGNPRLNLA
SFVTTWMEPECDKLMMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIGDDETAVGV
GTVGSSEAIMLAGLAFKRKWQNRMKAEGKPHDKPNIVTGANVQVCWEKFARYFEVELKEV
KLTQGYYVMNPEKAVEMVDENTICVAAILGSTLNGEFEDVKMLNDLLTAKNAETGWNTPI
HVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRNKEDLPDELI
FHINYLGADQPTFTLNFSKGSNQIIAQYYQLIRLGFEGYKDIMQNCRDNATVLREGIEKT
GHFDVVSKDSGVPLVAFSLKDSSRYTVFEVAESLRRFGWIVPAYTMPADAEHVAVMRVVI
REDFSRGLAERLITDLTKTVADMDAHAVKKAAAEPAKKTVREIEKEVTTYWRSFVARKKS
SLVC*

5'UTR

chr04:22316319..22316433 (- strand) : 115 bp

CDS

chr04:22316031..22316318 (- strand) : 288 bp

chr04:22315537..22315952 (- strand) : 416 bp

chr04:22315187..22315440 (- strand) : 254 bp

chr04:22315050..22315102 (- strand) : 53 bp

chr04:22314426..22314869 (- strand) : 444 bp

3'UTR

chr04:22314079..22314425 (- strand) : 347 bp

FASTA

>Os04t0447400-01 class=Sequence position=chr04:22314079..22316433 (- strand)
CGCGTCGTCG TCCCCTCTCC TAGCTAGCGG CTATCAAACC CCCACACCAC TGCTCGATCG ATCGTCGCAG CCGGAGTAAC
TAAGGCAGAG ATCAGATCAG GCGAATTAGG AGCATATGGC GCTGTCGACG GCGCAGACAG GGGAGTCGAT GCACTCCTCG
ACGTTCGCGT CGCGGTACGT GCGCACGGCG CTGCCGAGGT TCAGGATGCC GGAGAAGTCG ATCCCCAAGG ACGCGGCGTA
CCAGATCATC AACGACGAGC TGATGCTCGA CGGCAACCCG CGCCTGAACC TGGCGTCCTT CGTCACCACG TGGATGGAGC
CCGAGTGCGA CAAGCTCATG ATGGCCGCCA TCAACAAGAA CTACGTCGAC ATGGATGAGT ACCCCGTCAC CACCGAGCTC
CAGGTAAACA ACCACCACGA CAACAACAAA CACCTCTGCA TCTGCACAAC GCATCATGTC TAACACGGAT CCGATGAACA
GAACCGGTGC GTGAACATGA TCGCGCATCT GTTCAACGCG CCGATCGGGG ACGACGAGAC GGCGGTCGGG GTGGGCACGG
TGGGGTCGTC GGAGGCCATC ATGCTGGCGG GGCTGGCGTT CAAGAGGAAG TGGCAGAACA GGATGAAGGC CGAGGGGAAG
CCCCACGACA AGCCCAACAT CGTGACGGGG GCCAACGTGC AGGTGTGCTG GGAGAAGTTC GCGCGCTACT TCGAGGTGGA
GCTCAAGGAG GTGAAGCTGA CCCAAGGGTA CTACGTGATG AACCCGGAGA AGGCCGTGGA GATGGTCGAC GAGAACACCA
TCTGCGTCGC CGCCATCCTC GGCTCCACCC TCAACGGCGA GTTCGAGGAC GTCAAGATGC TCAACGACCT CCTCACCGCC
AAGAACGCCG AGACAGGGTA AGACACCTCG CCGATCTCTG CATTCACTGC ACGAAAATGC CAAAATTAAC TCAAGAAGTC
AAGATCATTG ATCGATCTGA GAATGCATGA CAGGTGGAAC ACGCCGATCC ATGTGGACGC GGCGAGCGGC GGGTTCATCG
CGCCGTTCAT CTACCCGGAG CTGGAGTGGG ACTTCCGGCT GCCGCTGGTG AAGAGCATCA ACGTCAGCGG CCACAAGTAC
GGGCTCGTCT ACGCCGGCGT CGGGTGGGTC ATCTGGCGCA ACAAGGAGGA CCTCCCCGAT GAGCTCATCT TCCACATCAA
CTACCTCGGC GCCGACCAGC CAACCTTCAC GCTCAACTTC TCCAAAGGTG CATGCCCGTT TTGCATACGT GATTACCTTT
GGATAATTGC ACATCCAGTA ATCTGATTTT TCTACCCTGT TCTGATAATA GGATCGAACC AGATAATTGC GCAGTATTAC
CAGCTCATTC GTCTCGGATT CGAGGTAATA TAACTACTCT TTTTTTGCAA CTACACGGAA TCATGTGTGT TGATTGCATC
AGCGAGAAAC CCTGGATGTT TGGATTCAAG TTCATGCATT CCGAATGGTT GCATCGTTTG TTGGGATCCT GTCGGCTGTA
CCTATTTGAT CATGCGAAAC CGAATGTTGC TGTTCGTGAT GCAGGGGTAC AAGGACATCA TGCAGAACTG CCGGGACAAC
GCGACGGTGC TCCGGGAGGG GATCGAGAAG ACGGGCCACT TCGACGTGGT GTCCAAGGAC TCCGGCGTGC CGCTGGTGGC
CTTCTCCCTC AAGGACTCGT CGCGGTACAC GGTGTTCGAG GTGGCCGAGA GCCTCCGCCG CTTCGGCTGG ATCGTGCCGG
CGTACACCAT GCCCGCCGAC GCTGAGCACG TCGCCGTGAT GCGCGTCGTC ATCCGCGAGG ACTTCAGCCG CGGCCTCGCC
GAGCGCCTCA TCACCGACCT CACCAAGACG GTGGCCGATA TGGACGCCCA CGCCGTCAAG AAGGCCGCCG CCGAGCCGGC
CAAGAAGACC GTGCGGGAGA TAGAGAAGGA GGTGACCACC TACTGGCGGA GTTTCGTCGC CAGGAAGAAG AGCAGCCTCG
TCTGCTGATC ATCGACTCCT GCACTCGCGC GTACATAAAG TGCAGGAACG AATAATTCTT GACCCGTCTT GCATTGAGTT
CTTCGTTTGC TGCTGCTTCT TTTCTTTTTT TTTTTCCTTT TCACCCGCTG AATTTTGAGT TCAGTTTCAA ATTCGCTTCG
ATAGATTTGT GTATGTCACA CCGATTTGTG GCATTCTTGC AGACAAGTTA CCAATATGAA ATGCGTATAG GCATGTACAC
GCAGAGACGT GTCAGGCAGA ACAGAAGTGA GATGCACCGA TCTGTACCGG CCATGGCATG GAATTGGTTT GTCATGGGCT
ATAGTTGGtt gacagaataa gttcattttg tgacc