Os04t0447800-01

Locus

Os04g0447800

Description

Glutamate decarboxylase (EC 4.1.1.15).

Transcript Evidence

AK068340 (DDBJ, Best hit)

Protein Evidence

Q01J81 (UniProt)

CGSNL Gene Symbol

_

CGSNL Gene Name

_

CGSNL Gene Symbol Synonym(s)

OsGAD2

CGSNL Gene Name Synonym(s)

glutamate decarboxylase 2

Literature (PMID)

Manual Curation

Note

GO

Biological Process: glutamate metabolic process (GO:0006536)

Biological Process: carboxylic acid metabolic process (GO:0019752)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: glutamate decarboxylase activity (GO:0004351)

Molecular Function: carboxy-lyase activity (GO:0016831)

Molecular Function: pyridoxal phosphate binding (GO:0030170)

InterPro

Pyridoxal phosphate-dependent decarboxylase (IPR002129)

Glutamate decarboxylase (IPR010107)

Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (IPR015421)

Pyridoxal phosphate-dependent transferase, major domain (IPR015424)

KEGG

Os04t0447800-01 (EC:4.1.1.15)

KOME

J013151F09 (Online Clone Ordering)

RiceXPro Database

AK068340

Oryzabase

14092

Plant Gene Family Database (PGFD)

Os04t0447800-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os04t0447800-01

Transcript

1753 bp

>Os04t0447800-01 Glutamate decarboxylase (EC 4.1.1.15).
GGTGGCCAAAACGAGACGTGCAGAGAGAGACACCAATCTCGTACGTAGCATATCTACATC
GCAGGAACACCCAAATCACTCGTGCGTAGGTATGGTTCTGACGCACGTCGAGGCGGTGGA
GGAGGGCAGCGAGGCGGCGGCCGCCGTGTTCGCGTCGAGGTACGTGCAGGACCCGGTGCC
GAGGTACGAGCTCGGCGAGAGGTCGATATCCAAGGACGCCGCGTACCAGATCGTCCACGA
CGAGCTCCTCCTGGACAGCAGCCCGCGCCTGAACCTGGCGTCCTTCGTCACCACCTGGAT
GGAGCCCGAGTGCGACAGGCTCATCCTCGAGGCCATCAACAAGAACTACGCCGACATGGA
CGAGTACCCCGTCACCACCGAGCTCCAGAACCGGTGCGTGAACATCATAGCGAGGCTGTT
CAATGCGCCGGTGGGCGACGGCGAGAAGGCGGTCGGGGTGGGCACGGTGGGGTCGTCGGA
GGCCATAATGCTGGCCGGGCTGGCGTTCAAGCGGCGGTGGCAGAACCGGCGGAAGGCGGC
GGGGAAGCCCCACGACAAGCCCAACATCGTGACGGGGGCCAACGTGCAGGTGTGCTGGGA
GAAGTTCGCGCGCTACTTCGAGGTGGAGCTCAAGGAGGTGAAGCTGACCGAAGGCTGCTA
CGTGATGGACCCCGTCAAGGCCGTGGACATGGTCGACGAGAACACCATCTGCGTCGCCGC
CATCCTCGGCTCCACCCTCACCGGCGAGTTCGAGGACGTCAGGCGCCTCAACGACCTCCT
CGCCGCCAAGAACAAGCGGACGGGTTGGGACACGCCGATCCACGTCGACGCGGCGAGCGG
CGGGTTCATCGCGCCGTTCATCTACCCGGAGCTGGAGTGGGACTTCCGGCTGCCGCTGGT
GAAGAGCATCAACGTCAGCGGCCACAAGTACGGGCTCGTCTACGCCGGCGTCGGGTGGGT
CATCTGGCGCAACAAGGAGGACCTCCCCGAGGAGCTCATCTTCCACATCAACTACCTCGG
CGCCGACCAGCCAACCTTCACGCTCAACTTCTCCAAAGGGTCCAGTCAGATTATTGCGCA
ATATTACCAGTTTCTTCGACTCGGATTTGAGGGGTACAAGAGCGTGATGAAGAACTGCAT
GGAGAGCGCGAGGACGCTCCGGGAGGGCCTGGAGAAGACGGGGCGGTTCACCATCATCTC
CAAGGAGGAGGGCGTGCCGCTGGTGGCCTTCACGTTCAAGGACGGCGCCGGCGCGCAGGC
CTTCAGGCTGTCGTCGGGCCTGCGCCGGTACGGGTGGATCGTGCCGGCGTACACGATGCC
GGCGGCGCTGGAGCACATGACGGTGCTCCGCGTCGTCGTCCGGGAAGACTTCGGCCGGCC
GCTCGCCGAGCGGTTCCTGTCCCACGTCAGGATGGCCCTGGACGAGATGGACCTCGCCGC
CAGGGCCCCCGTGCCCAGGGTGCAGCTCACCATCGAGCTCGGCCCCGCCCGGACCGCCGG
CGAGGAGGCCTCGATCAGGGTGGTCAAGAGCGAGGCCGTGCCCGTGCGCAAGAGCGTCCC
GCTCGTCGCCGGCAAAACCAAGGGCGTTTGCTAGACCGGGTTAAATTTTTTTTTAAAATA
CTGGTGGGAACACGACCAAAATAAAATTTCAAAATGGGAGCGTACTAAACCTTCTTTATG
CTACAGTAACTATGTAGTACAAGCATGCCGAAAGTTAATCATCGTGTGTAATCGTATTAG
AGTTTGCAACAGC

CDS

1503 bp

>Os04t0447800-01 Glutamate decarboxylase (EC 4.1.1.15).
ATGGTTCTGACGCACGTCGAGGCGGTGGAGGAGGGCAGCGAGGCGGCGGCCGCCGTGTTC
GCGTCGAGGTACGTGCAGGACCCGGTGCCGAGGTACGAGCTCGGCGAGAGGTCGATATCC
AAGGACGCCGCGTACCAGATCGTCCACGACGAGCTCCTCCTGGACAGCAGCCCGCGCCTG
AACCTGGCGTCCTTCGTCACCACCTGGATGGAGCCCGAGTGCGACAGGCTCATCCTCGAG
GCCATCAACAAGAACTACGCCGACATGGACGAGTACCCCGTCACCACCGAGCTCCAGAAC
CGGTGCGTGAACATCATAGCGAGGCTGTTCAATGCGCCGGTGGGCGACGGCGAGAAGGCG
GTCGGGGTGGGCACGGTGGGGTCGTCGGAGGCCATAATGCTGGCCGGGCTGGCGTTCAAG
CGGCGGTGGCAGAACCGGCGGAAGGCGGCGGGGAAGCCCCACGACAAGCCCAACATCGTG
ACGGGGGCCAACGTGCAGGTGTGCTGGGAGAAGTTCGCGCGCTACTTCGAGGTGGAGCTC
AAGGAGGTGAAGCTGACCGAAGGCTGCTACGTGATGGACCCCGTCAAGGCCGTGGACATG
GTCGACGAGAACACCATCTGCGTCGCCGCCATCCTCGGCTCCACCCTCACCGGCGAGTTC
GAGGACGTCAGGCGCCTCAACGACCTCCTCGCCGCCAAGAACAAGCGGACGGGTTGGGAC
ACGCCGATCCACGTCGACGCGGCGAGCGGCGGGTTCATCGCGCCGTTCATCTACCCGGAG
CTGGAGTGGGACTTCCGGCTGCCGCTGGTGAAGAGCATCAACGTCAGCGGCCACAAGTAC
GGGCTCGTCTACGCCGGCGTCGGGTGGGTCATCTGGCGCAACAAGGAGGACCTCCCCGAG
GAGCTCATCTTCCACATCAACTACCTCGGCGCCGACCAGCCAACCTTCACGCTCAACTTC
TCCAAAGGGTCCAGTCAGATTATTGCGCAATATTACCAGTTTCTTCGACTCGGATTTGAG
GGGTACAAGAGCGTGATGAAGAACTGCATGGAGAGCGCGAGGACGCTCCGGGAGGGCCTG
GAGAAGACGGGGCGGTTCACCATCATCTCCAAGGAGGAGGGCGTGCCGCTGGTGGCCTTC
ACGTTCAAGGACGGCGCCGGCGCGCAGGCCTTCAGGCTGTCGTCGGGCCTGCGCCGGTAC
GGGTGGATCGTGCCGGCGTACACGATGCCGGCGGCGCTGGAGCACATGACGGTGCTCCGC
GTCGTCGTCCGGGAAGACTTCGGCCGGCCGCTCGCCGAGCGGTTCCTGTCCCACGTCAGG
ATGGCCCTGGACGAGATGGACCTCGCCGCCAGGGCCCCCGTGCCCAGGGTGCAGCTCACC
ATCGAGCTCGGCCCCGCCCGGACCGCCGGCGAGGAGGCCTCGATCAGGGTGGTCAAGAGC
GAGGCCGTGCCCGTGCGCAAGAGCGTCCCGCTCGTCGCCGGCAAAACCAAGGGCGTTTGC
TAG

Protein

501 aa

>Os04t0447800-01 Glutamate decarboxylase (EC 4.1.1.15).
MVLTHVEAVEEGSEAAAAVFASRYVQDPVPRYELGERSISKDAAYQIVHDELLLDSSPRL
NLASFVTTWMEPECDRLILEAINKNYADMDEYPVTTELQNRCVNIIARLFNAPVGDGEKA
VGVGTVGSSEAIMLAGLAFKRRWQNRRKAAGKPHDKPNIVTGANVQVCWEKFARYFEVEL
KEVKLTEGCYVMDPVKAVDMVDENTICVAAILGSTLTGEFEDVRRLNDLLAAKNKRTGWD
TPIHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRNKEDLPE
ELIFHINYLGADQPTFTLNFSKGSSQIIAQYYQFLRLGFEGYKSVMKNCMESARTLREGL
EKTGRFTIISKEEGVPLVAFTFKDGAGAQAFRLSSGLRRYGWIVPAYTMPAALEHMTVLR
VVVREDFGRPLAERFLSHVRMALDEMDLAARAPVPRVQLTIELGPARTAGEEASIRVVKS
EAVPVRKSVPLVAGKTKGVC*

5'UTR

chr04:22330191..22330281 (+ strand) : 91 bp

CDS

chr04:22330282..22330575 (+ strand) : 294 bp

chr04:22330680..22331350 (+ strand) : 671 bp

chr04:22331442..22331496 (+ strand) : 55 bp

chr04:22331702..22332184 (+ strand) : 483 bp

3'UTR

chr04:22332185..22332343 (+ strand) : 159 bp

FASTA

>Os04t0447800-01 class=Sequence position=chr04:22330191..22332343 (+ strand)
GGTGGCCAAA ACGAGACGTG CAGAGAGAGA CACCAATCTC GTACGTAGCA TATCTACATC GCAGGAACAC CCAAATCACT
CGTGCGTAGG TATGGTTCTG ACGCACGTCG AGGCGGTGGA GGAGGGCAGC GAGGCGGCGG CCGCCGTGTT CGCGTCGAGG
TACGTGCAGG ACCCGGTGCC GAGGTACGAG CTCGGCGAGA GGTCGATATC CAAGGACGCC GCGTACCAGA TCGTCCACGA
CGAGCTCCTC CTGGACAGCA GCCCGCGCCT GAACCTGGCG TCCTTCGTCA CCACCTGGAT GGAGCCCGAG TGCGACAGGC
TCATCCTCGA GGCCATCAAC AAGAACTACG CCGACATGGA CGAGTACCCC GTCACCACCG AGCTCCAGGC AAGCAATCAA
ACAAACCAAA CCATATACCC TCGTCTCCTC CATATCCTTT CGTTGCATTG CGTTGTGGTT GACGTACGAC GACGATGGCC
CTGGCGTTGC AGAACCGGTG CGTGAACATC ATAGCGAGGC TGTTCAATGC GCCGGTGGGC GACGGCGAGA AGGCGGTCGG
GGTGGGCACG GTGGGGTCGT CGGAGGCCAT AATGCTGGCC GGGCTGGCGT TCAAGCGGCG GTGGCAGAAC CGGCGGAAGG
CGGCGGGGAA GCCCCACGAC AAGCCCAACA TCGTGACGGG GGCCAACGTG CAGGTGTGCT GGGAGAAGTT CGCGCGCTAC
TTCGAGGTGG AGCTCAAGGA GGTGAAGCTG ACCGAAGGCT GCTACGTGAT GGACCCCGTC AAGGCCGTGG ACATGGTCGA
CGAGAACACC ATCTGCGTCG CCGCCATCCT CGGCTCCACC CTCACCGGCG AGTTCGAGGA CGTCAGGCGC CTCAACGACC
TCCTCGCCGC CAAGAACAAG CGGACGGGTT GGGACACGCC GATCCACGTC GACGCGGCGA GCGGCGGGTT CATCGCGCCG
TTCATCTACC CGGAGCTGGA GTGGGACTTC CGGCTGCCGC TGGTGAAGAG CATCAACGTC AGCGGCCACA AGTACGGGCT
CGTCTACGCC GGCGTCGGGT GGGTCATCTG GCGCAACAAG GAGGACCTCC CCGAGGAGCT CATCTTCCAC ATCAACTACC
TCGGCGCCGA CCAGCCAACC TTCACGCTCA ACTTCTCCAA AGGCACGAAA TTATTTTTCC AGAATTAAAT GATCCGTACA
TATATAGAGT GGAGTAGTAC ATTTTGTGAC TTGGCAAGTT CATTTTTGTG CAGGGTCCAG TCAGATTATT GCGCAATATT
ACCAGTTTCT TCGACTCGGA TTTGAGGTAT ACTGAgacta attgccccaa aatttcgaat ttaaaatttt gaaaatttta
tGTCAAACTC CTATAATTTC GATTTTTTTT TTGGCCGGAT GCACATCCTA CCGGAACACA CCGGCATAAC TGAAATTTCG
CAAAATTCTT TCTGAAATTG TGCACATTTA TTTCAGTTTG ATTGAACCGT TGGGTTGTTT GATTGTTGCA GGGGTACAAG
AGCGTGATGA AGAACTGCAT GGAGAGCGCG AGGACGCTCC GGGAGGGCCT GGAGAAGACG GGGCGGTTCA CCATCATCTC
CAAGGAGGAG GGCGTGCCGC TGGTGGCCTT CACGTTCAAG GACGGCGCCG GCGCGCAGGC CTTCAGGCTG TCGTCGGGCC
TGCGCCGGTA CGGGTGGATC GTGCCGGCGT ACACGATGCC GGCGGCGCTG GAGCACATGA CGGTGCTCCG CGTCGTCGTC
CGGGAAGACT TCGGCCGGCC GCTCGCCGAG CGGTTCCTGT CCCACGTCAG GATGGCCCTG GACGAGATGG ACCTCGCCGC
CAGGGCCCCC GTGCCCAGGG TGCAGCTCAC CATCGAGCTC GGCCCCGCCC GGACCGCCGG CGAGGAGGCC TCGATCAGGG
TGGTCAAGAG CGAGGCCGTG CCCGTGCGCA AGAGCGTCCC GCTCGTCGCC GGCAAAACCA AGGGCGTTTG CTAGACCGGG
TTAAATTTTT TTTTAAAATA CTGGTGGGAA CACGACCAAA ATAAAATTTC AAAATGGGAG CGTACTAAAC CTTCTTTATG
CTACAGTAAC TATGTAGTAC AAGCATGCCG AAAGTTAATC ATCGTGTGTA ATCGTATTAG AGTTTGCAAC AGC