Os04t0540600-01

Locus

Os04g0540600

Description

Aldehyde dehydrogenase domain containing protein.

Transcript Evidence

AK071169 (DDBJ, Best hit)

Protein Evidence

Q71LY7 (UniProt)

CGSNL Gene Symbol

CGSNL Gene Name

CGSNL Gene Symbol Synonym(s)

CGSNL Gene Name Synonym(s)

Literature (PMID)

Manual Curation

Note

GO

Biological Process: cellular aldehyde metabolic process (GO:0006081)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: aldehyde dehydrogenase [NAD(P)+] activity (GO:0004030)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620)

InterPro

Aldehyde dehydrogenase NAD(P)-dependent (IPR012394)

Aldehyde dehydrogenase domain (IPR015590)

Aldehyde/histidinol dehydrogenase (IPR016161)

Aldehyde dehydrogenase, N-terminal (IPR016162)

Aldehyde dehydrogenase, C-terminal (IPR016163)

KEGG

Os04t0540600-01

KOME

J023081H03 (Online Clone Ordering)

RiceXPro Database

AK071169

Plant Gene Family Database (PGFD)

Os04t0540600-01

Transcript

2054 bp

>Os04t0540600-01 Aldehyde dehydrogenase domain containing protein.
ACTTTTTCGGTCCTAGCAACCGGCAGTAGTACCAATGATGCACCTTTGCACCAGTTTACA
ACAATAATGGACGTCAATTCTACTGAACCGCCCTGGTGCCAGCATTTAATTCGTATCATG
CATTCATGCGTAGCGTAGGCCATAGGCTCAAGCGCACGTCAGTTGCCATAAATTGGCCTC
GCCGGCCCGAGGCTTTCTTCAACTTTCTGCTTGCAAAGTTTCAATACACTGGAGTGAGTC
AGTGAGGTTGGTGAAGCAGAGTGAGGAAAGGAGGATGGGAAGGGTGGCGCCTAGCGTCGA
GGAGGTCGGGGGCGAGCAGCCGCCGCCCGCGCTTGGGCCCGGCGAGACCGTGAGCGGGAC
GGTGGCCGAGCTGAGGGCGGCGTACGAGAGCGGCAGGACGCGGAGCCTGGAGTGGAGGCA
GTCGCAGCTCCGGGGGCTCCTCCGGCTCTTGGCGGAGGAGGAGGCCGCCGCGTTCCGGGC
GCTCCGCGAGGACCTCGGCAAGCACCAAGCCGAGGCCTACAGAGACGAGATCGGCGTGCT
TGTCAAGTCGGCGAACGCCGCGCTGCGTGAGGTCGGGAAATGGATGGCGCCGGAGAAGGT
CTGGGTGCCGCTAATCGCGTTCCCGGCAAGGGCGCAGCTGGAGCCGCAGCCGCTCGGGGT
CATCCTCGTCTTCTCTTGCTGGAATGTCCCGTTGGGCCTCTCTCTGGAGCCTCTCGTTGG
AGCATTGGCGGCCGGCAATGCGGTCGCGCTGAAGCCATCGGAGCTGGCGCCGGCCACCGC
TAAGTTCCTCGGCGACAACGTCGGCAAATACATGGACGCCACGGCCGTGAAGGTCATCCA
GGGCGGGCCGGAGGTTGGCGAGCAGCTCATGGAACACAGATGGGACAAGGTCCTTTTCAC
CGGGAGCCCGCGCATCGCGCGCGTCGTGATGGCCGCGGCCGCGAAGCACCTGACGCCCGT
GGCGCTTGAGCTCGGCGGGAAGTGCCCCTGCATCTTCGACACGATCGGCGGCAGCGCGCG
GGACCTGCAGACCGCGGTGAACCGCGTCGTCGGGGGCAAGTGGTCGTCCTGCGCCGGCCA
GGCCTGCCTGGCCATCGACTACGTCCTCGTCGAGGAGCGCTTCGTGCCCGTCCTGATCAA
GGCGCTCAAGTCGACGCTGAAGAAGTTCTTCGCCGACTCGGACCACATGGCGCGGATCGT
CAACGCGAGGCACTTCCAGCGGCTGAGTGACCTTCTCAAGGACAAATCGGTCGCGGCGTC
CGTCCTCCACGGGGGCACATTGGACGCCAAGAACCTGTGCATCGAGCCCACGATTCTGCT
GAATCCCCCACTCGACTCCGCGATCATGACAGAGGAGATTTTCGGCCCTCTCCTGCCCAT
CATCACGGTGAAGAAGATAGAGGACAGCATCGCCTTCGTGAGAGCGCGGCCGAGGCCGCT
CGCCGTCTACGCGTTCACCAAAAACGCCGCACTGAGGCGCCGAATCGTCGAGGAGACGTC
GTCGGGGAGCGTTACGTTCAACGACGCAGTTGTACAATACGGGATCGATTCGCTGCCGTT
CGGCGGCGTCGGCGAGAGCGGATTCGGGCAGTACCACGGCAAGTACTCCTTCGAGATGTT
CAGCCACAAGAAGGCGGTTCTGACGAGAGGATACCTTATCGAGCTGACGGCCAGGTACCC
GCCGTGGGATGACAGCAAGATCTCCATGATGCGACAGCTCTACCGTTACAATTACGTCGG
ATTCGTCTTAACCTTCCTCGGTCTAAAGAAGTGAAAATTTGGTGGGAAGGAATTGGTGAT
CGCTTTTGTGGAGTTCAAAGTGAGTGCATTTAGCCCAAGAGACTACTGATGAGAATAAAT
ATAGACTTATATCGCTTAGTGAATAAGAACAAGATTTGCAGTTGCTAGTATAAAGCAGCA
AAAATGTACTGCCTGCATTATATAAGAAAAATGCGCTACCTGTAATTTACGTTTCGTCAA
GAAACCACCTTTTAAGTAAGGTAAATGTAAGGTACTAAGGTGCAATTTCAGTAGTTTTGG
GTTGAATTTCAGCC

CDS

1500 bp

>Os04t0540600-01 Aldehyde dehydrogenase domain containing protein.
ATGGGAAGGGTGGCGCCTAGCGTCGAGGAGGTCGGGGGCGAGCAGCCGCCGCCCGCGCTT
GGGCCCGGCGAGACCGTGAGCGGGACGGTGGCCGAGCTGAGGGCGGCGTACGAGAGCGGC
AGGACGCGGAGCCTGGAGTGGAGGCAGTCGCAGCTCCGGGGGCTCCTCCGGCTCTTGGCG
GAGGAGGAGGCCGCCGCGTTCCGGGCGCTCCGCGAGGACCTCGGCAAGCACCAAGCCGAG
GCCTACAGAGACGAGATCGGCGTGCTTGTCAAGTCGGCGAACGCCGCGCTGCGTGAGGTC
GGGAAATGGATGGCGCCGGAGAAGGTCTGGGTGCCGCTAATCGCGTTCCCGGCAAGGGCG
CAGCTGGAGCCGCAGCCGCTCGGGGTCATCCTCGTCTTCTCTTGCTGGAATGTCCCGTTG
GGCCTCTCTCTGGAGCCTCTCGTTGGAGCATTGGCGGCCGGCAATGCGGTCGCGCTGAAG
CCATCGGAGCTGGCGCCGGCCACCGCTAAGTTCCTCGGCGACAACGTCGGCAAATACATG
GACGCCACGGCCGTGAAGGTCATCCAGGGCGGGCCGGAGGTTGGCGAGCAGCTCATGGAA
CACAGATGGGACAAGGTCCTTTTCACCGGGAGCCCGCGCATCGCGCGCGTCGTGATGGCC
GCGGCCGCGAAGCACCTGACGCCCGTGGCGCTTGAGCTCGGCGGGAAGTGCCCCTGCATC
TTCGACACGATCGGCGGCAGCGCGCGGGACCTGCAGACCGCGGTGAACCGCGTCGTCGGG
GGCAAGTGGTCGTCCTGCGCCGGCCAGGCCTGCCTGGCCATCGACTACGTCCTCGTCGAG
GAGCGCTTCGTGCCCGTCCTGATCAAGGCGCTCAAGTCGACGCTGAAGAAGTTCTTCGCC
GACTCGGACCACATGGCGCGGATCGTCAACGCGAGGCACTTCCAGCGGCTGAGTGACCTT
CTCAAGGACAAATCGGTCGCGGCGTCCGTCCTCCACGGGGGCACATTGGACGCCAAGAAC
CTGTGCATCGAGCCCACGATTCTGCTGAATCCCCCACTCGACTCCGCGATCATGACAGAG
GAGATTTTCGGCCCTCTCCTGCCCATCATCACGGTGAAGAAGATAGAGGACAGCATCGCC
TTCGTGAGAGCGCGGCCGAGGCCGCTCGCCGTCTACGCGTTCACCAAAAACGCCGCACTG
AGGCGCCGAATCGTCGAGGAGACGTCGTCGGGGAGCGTTACGTTCAACGACGCAGTTGTA
CAATACGGGATCGATTCGCTGCCGTTCGGCGGCGTCGGCGAGAGCGGATTCGGGCAGTAC
CACGGCAAGTACTCCTTCGAGATGTTCAGCCACAAGAAGGCGGTTCTGACGAGAGGATAC
CTTATCGAGCTGACGGCCAGGTACCCGCCGTGGGATGACAGCAAGATCTCCATGATGCGA
CAGCTCTACCGTTACAATTACGTCGGATTCGTCTTAACCTTCCTCGGTCTAAAGAAGTGA

Protein

500 aa

>Os04t0540600-01 Aldehyde dehydrogenase domain containing protein.
MGRVAPSVEEVGGEQPPPALGPGETVSGTVAELRAAYESGRTRSLEWRQSQLRGLLRLLA
EEEAAAFRALREDLGKHQAEAYRDEIGVLVKSANAALREVGKWMAPEKVWVPLIAFPARA
QLEPQPLGVILVFSCWNVPLGLSLEPLVGALAAGNAVALKPSELAPATAKFLGDNVGKYM
DATAVKVIQGGPEVGEQLMEHRWDKVLFTGSPRIARVVMAAAAKHLTPVALELGGKCPCI
FDTIGGSARDLQTAVNRVVGGKWSSCAGQACLAIDYVLVEERFVPVLIKALKSTLKKFFA
DSDHMARIVNARHFQRLSDLLKDKSVAASVLHGGTLDAKNLCIEPTILLNPPLDSAIMTE
EIFGPLLPIITVKKIEDSIAFVRARPRPLAVYAFTKNAALRRRIVEETSSGSVTFNDAVV
QYGIDSLPFGGVGESGFGQYHGKYSFEMFSHKKAVLTRGYLIELTARYPPWDDSKISMMR
QLYRYNYVGFVLTFLGLKK*

5'UTR

chr04:27048627..27048900 (- strand) : 274 bp

CDS

chr04:27048372..27048626 (- strand) : 255 bp

chr04:27048178..27048247 (- strand) : 70 bp

chr04:27047981..27048076 (- strand) : 96 bp

chr04:27045689..27045895 (- strand) : 207 bp

chr04:27045353..27045585 (- strand) : 233 bp

chr04:27045082..27045242 (- strand) : 161 bp

chr04:27044907..27044997 (- strand) : 91 bp

chr04:27044671..27044820 (- strand) : 150 bp

chr04:27044262..27044498 (- strand) : 237 bp

3'UTR

chr04:27043982..27044261 (- strand) : 280 bp

FASTA

>Os04t0540600-01 class=Sequence position=chr04:27043982..27048900 (- strand)
ACTTTTTCGG TCCTAGCAAC CGGCAGTAGT ACCAATGATG CACCTTTGCA CCAGTTTACA ACAATAATGG ACGTCAATTC
TACTGAACCG CCCTGGTGCC AGCATTTAAT TCGTATCATG CATTCATGCG TAGCGTAGGC CATAGGCTCA AGCGCACGTC
AGTTGCCATA AATTGGCCTC GCCGGCCCGA GGCTTTCTTC AACTTTCTGC TTGCAAAGTT TCAATACACT GGAGTGAGTC
AGTGAGGTTG GTGAAGCAGA GTGAGGAAAG GAGGATGGGA AGGGTGGCGC CTAGCGTCGA GGAGGTCGGG GGCGAGCAGC
CGCCGCCCGC GCTTGGGCCC GGCGAGACCG TGAGCGGGAC GGTGGCCGAG CTGAGGGCGG CGTACGAGAG CGGCAGGACG
CGGAGCCTGG AGTGGAGGCA GTCGCAGCTC CGGGGGCTCC TCCGGCTCTT GGCGGAGGAG GAGGCCGCCG CGTTCCGGGC
GCTCCGCGAG GACCTCGGCA AGCACCAAGC CGAGGCCTAC AGAGACGAGG TTAATTGATT AGTTGGCGAT GAATATGCAT
TTGGCATTTC CCGTGTGCCA AACTGCCAAC TGATCGATCT GCTGATATGA TTCCGTTTAA CTTGTATATA TGCGAATGGT
TGTGTGATTT TAGATCGGCG TGCTTGTCAA GTCGGCGAAC GCCGCGCTGC GTGAGGTCGG GAAATGGATG GCGCCGGAGA
AGGCAAGCCT GATCTGACCA CGCTTTAGTG TGCACTGTTC GATTATTTTA CATGAATGGT TTGCTTCTCC TGGTTCTGAG
TTCTGACGCC TCGCTGGTTG CAGGTCTGGG TGCCGCTAAT CGCGTTCCCG GCAAGGGCGC AGCTGGAGCC GCAGCCGCTC
GGGGTCATCC TCGTCTTCTC TTGCTGGAAT GTCCCGTTGG GTAAGCAAAC CATCATCAAT CTCTCACAGG TCACAGCGAT
TTTTTTTCCT TCGTTTACCC TTCTTCAAGC AAGAGCATTA GCAGAGAGTG CGGCTGCCCA TGTGAAGCAT TGTCAGGAAA
ACGGTGCTAC TCTCGCATTG ATGAATCGGT CCATTAAATT TTCACCTATA CTTTGTCGGG ACAAATATAG CTATGGCTGC
CTGCCATGCG GCGATGCATG CTGCTAGCAG TACAAGAGTA TAGAAGAATA GCAATATATA TATAGCAAAC GTATATACGG
AGTATTAGAA GGCTCTATTC GATTTATTGT GTTTGTGTGA GGGTATTTAA CGTCGAAAAT CGCTATACAT ATGACTGGTA
TGTCCGACCA GCACTTAGCT GCTACTCCGT AACTGCTCTG GCCCACATAG AGGCCCACAT AGAGAGAAGT TGGTCTGCGT
GGAGCGAAAC GATTGGTAGA TAAGGTTGGA TTGGATGGGG GTCGGACGAG GAAATCGGAC GTATAGCAAC ACTCATTTAC
GTCCTACCGA TTGTCTGGCT GGCCAACACT CCTTCAGCTC AAAGGGTGTA CTAGTACCAT AGCTCAGTGC ACATGATTAG
CTTACGATAG TCCTTGAATT GTCGGATTCA ATACAGCTTT TGAGTTTAAG TAACAGCGAA TAGCTGTGCT ATGGTATCCT
GTTGCTAGTA GGGCCAGTTG CTAACATGCA AACTTTGATT ATTCGTAGTA GTACTTCAGA CGAATATATC TCTCCGTCCC
AGAAAAACTC AACATACACA GAGCTACCAC TGTTTCTTTT GGTAGCTAGT TTGACGCTTG ATAGTTGGAA CTAAAGTACT
TTTCTTTTGG GTGGCAATCA GTTTATACTT GGGGCGTTGT CTCAGAATAT TGCTTCAGTC GTCAAACCCA ATGTTCAGCA
TGTTTCTTTC TGAAAAAATC CGAATACCCC TCCCTCCCCC CAAAAAAAAA attgtagtac tacgaattac ctccctcaat
taaaaaacta gacattcttc atcgtcctca atttttaata ccagacgaat tatccctcga atagactcca aagtggttta
ggtcctacat gacacatgtg gcagtccagt catcataaaa atacattaaa aAGATAGGGA CCACATGTAC TGACCAAGag
aagcataact gacaagtggg ccccatattt gtttatatat tttttatgct gattggactt ccatgtgtgt gccacgtagg
actgaaactg ctttggagtt ggccttcgtt cagtgtaaca agttgagggt gaaaaaatat gtttgttttt ttaattgaga
gaggtaattc GTACGGATTG AGATCCTGAC TTTAGGTGTT AAAGTCAGAG GTTAACAGTA CCGTGACTTT CTACAGTAAA
AACTGCAAAT CACTGTTTTT TTTACTATAG CAACATACTT ATTTCACTGT GTGCTCAAAA GGGTAATTTG GACTTTCTAC
TTTTTTTTTC TTTTTTGCAA AAACAGCGTA TTAGCATGTG TACCCCTGCT ATGCTCGCCT CAGCATAAAC CAAGCGACGt
actccctccg tcttaaaata agtgcagttt tttattattc acgtttaacg tttgaccgtt cgtcttattt aaattttttt
tatgattagt atttttattg ctattagatg ataaaacatg aataatactt tatgtgtgac taaatatttt taaatttttc
acaaattttt caaataagac agatggttaa acgttgggca cgaatatcta tagctgcact tattttggga cggtgatagt
aCTAGCTAGC ATGTGATACA GCAGTCAGAA TTTTCACAGG CAGTGAAATT GTGAAAAACG TAAATGACTG ACCGTTCATC
TGCGCGCGGT CTGCGCCTGT GGATGTCACT CTGGCTACCA CAATCCACAG CCTTTGCACA TGCATGCATG TAATAATCCA
GAGAGTAGAG ACGCAAGGGT GGGTGCCCAC GAGGCCATGA GGGACAAGGG TAGTACACTG ACTGGCTACT TTTGGGTACT
GTATCAACTA ATCAGGCAAC GACTTTGTGT GCTCTATGCA TGCAGGCCTC TCTCTGGAGC CTCTCGTTGG AGCATTGGCG
GCCGGCAATG CGGTCGCGCT GAAGCCATCG GAGCTGGCGC CGGCCACCGC TAAGTTCCTC GGCGACAACG TCGGCAAATA
CATGGACGCC ACGGCCGTGA AGGTCATCCA GGGCGGGCCG GAGGTTGGCG AGCAGCTCAT GGAACACAGA TGGGACAAGG
TCCTTTTCAC CGGTAATATA ACCATGGTCC ATGGAGGACA CACTGGTAGC TTTTGGGTCC CCCGGCTGAA ACGCCGTTGA
TATGTGTTGG GTTTCTGTCG CGCGCGGCAT TGCAGGGAGC CCGCGCATCG CGCGCGTCGT GATGGCCGCG GCCGCGAAGC
ACCTGACGCC CGTGGCGCTT GAGCTCGGCG GGAAGTGCCC CTGCATCTTC GACACGATCG GCGGCAGCGC GCGGGACCTG
CAGACCGCGG TGAACCGCGT CGTCGGGGGC AAGTGGTCGT CCTGCGCCGG CCAGGCCTGC CTGGCCATCG ACTACGTCCT
CGTCGAGGAG CGCTTCGTGC CCGTCCTGGT GCGTTTTCAC CTCACGTCAC GCCTCCTCTG CTTTGCTACC CGAGTCGCAT
TTGTGCCTGA CGTTTGTGTG TCTGTCTCGC GGCGTGCACG TGTCGGTCTC GTCCGAAGAT CAAGGCGCTC AAGTCGACGC
TGAAGAAGTT CTTCGCCGAC TCGGACCACA TGGCGCGGAT CGTCAACGCG AGGCACTTCC AGCGGCTGAG TGACCTTCTC
AAGGACAAAT CGGTCGCGGC GTCCGTCCTC CACGGGGGCA CATTGGACGC CAAGAACCTG TAAATTCTGA ACAAAACTGC
GTGTCGTTGA TCAATCTGTC GGTAAGACAA CCCAAAGTTG ACCAACTCAC GAAAAAATTT CAGGTGCATC GAGCCCACGA
TTCTGCTGAA TCCCCCACTC GACTCCGCGA TCATGACAGA GGAGATTTTC GGCCCTCTCC TGCCCATCAT CACGGTAAAT
TAAAAAGTTC TTAACATCCT CCTCTATGCA GAGCGGAGTA CCACTAGACA GATCAAATGA AACGGCTACC TTTCTCACAG
GTGAAGAAGA TAGAGGACAG CATCGCCTTC GTGAGAGCGC GGCCGAGGCC GCTCGCCGTC TACGCGTTCA CCAAAAACGC
CGCACTGAGG CGCCGAATCG TCGAGGAGAC GTCGTCGGGG AGCGTTACGT TCAACGACGC AGTTGTACAA GTATGCACAC
ACGCCTTACC CCACCCAGGC CTTGCTTGAT GGGCTTCAAT CTCGGCCCAT CAGTTTATAT GGGCCAAACT GAGCCCATCC
AAACAAGAAC ATAGGAATTG CAGATCCAGT ACGTACTACA GAGTTATTTG ATGTCATCTT TTCTTGTGGC AATCCTCTGC
AGTACGGGAT CGATTCGCTG CCGTTCGGCG GCGTCGGCGA GAGCGGATTC GGGCAGTACC ACGGCAAGTA CTCCTTCGAG
ATGTTCAGCC ACAAGAAGGC GGTTCTGACG AGAGGATACC TTATCGAGCT GACGGCCAGG TACCCGCCGT GGGATGACAG
CAAGATCTCC ATGATGCGAC AGCTCTACCG TTACAATTAC GTCGGATTCG TCTTAACCTT CCTCGGTCTA AAGAAGTGAA
AATTTGGTGG GAAGGAATTG GTGATCGCTT TTGTGGAGTT CAAAGTGAGT GCATTTAGCC CAAGAGACTA CTGATGAGAA
TAAATATAGA CTTATATCGC TTAGTGAATA AGAACAAGAT TTGCAGTTGC TAGTATAAAG CAGCAAAAAT GTACTGCCTG
CATTATATAA GAAAAATGCG CTACCTGTAA TTTACGTTTC GTCAAGAAAC CACCTTTTAA GTAAGGTAAA TGTAAGGTAC
TAAGGTGCAA TTTCAGTAGT TTTGGGTTGA ATTTCAGCC