Os05t0187100-01

Locus

Os05g0187100

Description

Similar to Hexokinase.

Transcript Evidence

AK067988 (DDBJ, Best hit)

Protein Evidence

Q1WM16 (UniProt)

CGSNL Gene Symbol

HXK7

CGSNL Gene Name

HEXOKINASE-7

CGSNL Gene Symbol Synonym(s)

OsHXK7

CGSNL Gene Name Synonym(s)

Hexokinase 7, hexokinase 1

Literature (PMID)

Manual Curation

Note

GO

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: phosphotransferase activity, alcohol group as acceptor (GO:0016773)

InterPro

Hexokinase (IPR001312)

Hexokinase, N-terminal (IPR022672)

Hexokinase, C-terminal (IPR022673)

KEGG

Os05t0187100-01 (EC:2.7.1.1)

KOME

J013123D05 (Online Clone Ordering)

RiceXPro Database

AK067988

Oryzabase

9008

Plant Gene Family Database (PGFD)

Os05t0187100-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os05t0187100-01

Transcript

1775 bp

>Os05t0187100-01 Similar to Hexokinase.
AGAGACCTGTGTACGCGATCTTGGTTAGCTCCGGCCTTTGATCTTGACCACCAATCTCGC
ATTTCTTGGATCTTCTCGTCTTCCTCACTCCTCGATCGATCCATCGATTGGTTGCTGGTC
GGAGACCATGGTGGCGGCGGCGGTGGCGGCGGCGGAGCAGGTGGTGGCGGCGCTGCGGGA
GGAGTGCGCGACGCCGGCGGCGCGGCTGGATGGGGTGGCGGCGGCGATGGCCGGCGAGAT
GGCGGCGGGGTTGGCGGAGGAGGGCGGCAGCAAGATCAAGATGATCGTTTCCTACGTCGA
CAACCTCCCCAATGGGACCGAAGAGGGCTTGTTCTACGCGCTGGATCTTGGGGGAACAAA
CTTCCGAGTCCTGCGTGTGCAGCTTGCTGGAAAGGAGAAACGGGTCGTGAAGCGCGAGTC
GAGGGAGGTCTCGATCCCTCCCCATCTCATGTCCGGCAACTCCTCGGAGCTGTTTGGCTT
CATCGCTTCCGCGTTAGCCAAGTTCGTCGCTGATGAAGGACATAATGCCGTGTTCAACGA
CAGGCAAAGGGAACTGGGGTTCACCTTCTCTTTCCCTGTGCGGCAAACATCGATTGCGTC
TGGGACTCTTATCAAGTGGACCAAGGCGTTTTCTATTGATGATGCTGTAGGTGAAGATGT
GGTGGCCGAATTGCAGATGGCCATGGAGAAGCAAGGTCTGGACATGCGCGTTTCCGCATT
GATCAATGACACTGTTGGGACATTGGCGGCAGGCAGCTACTACGACGAAGATATTGTCGT
CGGTGTGATCTTAGGCACTGGCTCAAACGCCGCATATCTTGAGAAGGCAAATGCTATCCC
TAAGTTGGAAGGCGAGTTACCAAAATCAGGAAACATGGTTATTAATACAGAATGGGGTAA
CTTCTCCTCATCCTGTCTTCCAATAACAGAATATGATGAAGCACTAGATAAAGAGAGCTT
AAACCCTGGAGAGCAGATCTTCGAGAAATTGATTTCAGGAATGTATCTAGGTGAAATCGT
AAGGAGAGTGCTTCTTAAAATATCTTTGCAGTCTTCAATTTTTGGCAATCTAGATCAGAC
CAAGCTCAAAACCCGCTTTATTCTGAGGACTCCTGATATTTCCGTGATGCATCATGATGG
AACACCTGATCTCAGAATTGTGGCTGAAAAACTTGCAGATAACCTGAAGGTAATCTTCAT
CAGTAAATCCAGCATTGAACTGTATTCCCTCTATCCATTTTATGCACAATGAACACATTA
CACGGCATTGTCCACTTTTACCACAGATCACAGACACATCCTTAGAAACAAGGAAGATGG
TTGTCGAAATCTGTGACATCGTCACCCGAAGATCAGCCCGGCTGGCTGCTGCTGGGATCG
TAGGGATCCTCAGGAAGATCGGCAGAGGCGTCCCAGGCGACAAGCGAAAGTCGGTCATCG
CCATCGATGGCGGTCTATATGAACATTACACCGAATTCCGGCAGTGCCTGGAGACCACGC
TGACGGAGTTGCTCGGAGAAGAGGCGTCGAAGTCGGTGGCTGTCAAGCTTGCAAACGACG
GGTCTGGCCTTGGAGCTGCCCTGATTGCAGCTGCTCATTCTCAGTACCTGAATTGATTCC
CCATAGACAGAGTTCCAACTTTTATTAGTGACTCAGTGCTGTTGTTATAGTTTATAGAAT
GTGGTGAAGTTCTGTATGTTTCGAAGGAGCCTGATGGACTCTACAAACAAAATTTTCAGA
AATGAAATCGAAGCCAAATGTGTTGGTGGTGTTGC

CDS

1125 bp

>Os05t0187100-01 Similar to Hexokinase.
ATGGTGGCGGCGGCGGTGGCGGCGGCGGAGCAGGTGGTGGCGGCGCTGCGGGAGGAGTGC
GCGACGCCGGCGGCGCGGCTGGATGGGGTGGCGGCGGCGATGGCCGGCGAGATGGCGGCG
GGGTTGGCGGAGGAGGGCGGCAGCAAGATCAAGATGATCGTTTCCTACGTCGACAACCTC
CCCAATGGGACCGAAGAGGGCTTGTTCTACGCGCTGGATCTTGGGGGAACAAACTTCCGA
GTCCTGCGTGTGCAGCTTGCTGGAAAGGAGAAACGGGTCGTGAAGCGCGAGTCGAGGGAG
GTCTCGATCCCTCCCCATCTCATGTCCGGCAACTCCTCGGAGCTGTTTGGCTTCATCGCT
TCCGCGTTAGCCAAGTTCGTCGCTGATGAAGGACATAATGCCGTGTTCAACGACAGGCAA
AGGGAACTGGGGTTCACCTTCTCTTTCCCTGTGCGGCAAACATCGATTGCGTCTGGGACT
CTTATCAAGTGGACCAAGGCGTTTTCTATTGATGATGCTGTAGGTGAAGATGTGGTGGCC
GAATTGCAGATGGCCATGGAGAAGCAAGGTCTGGACATGCGCGTTTCCGCATTGATCAAT
GACACTGTTGGGACATTGGCGGCAGGCAGCTACTACGACGAAGATATTGTCGTCGGTGTG
ATCTTAGGCACTGGCTCAAACGCCGCATATCTTGAGAAGGCAAATGCTATCCCTAAGTTG
GAAGGCGAGTTACCAAAATCAGGAAACATGGTTATTAATACAGAATGGGGTAACTTCTCC
TCATCCTGTCTTCCAATAACAGAATATGATGAAGCACTAGATAAAGAGAGCTTAAACCCT
GGAGAGCAGATCTTCGAGAAATTGATTTCAGGAATGTATCTAGGTGAAATCGTAAGGAGA
GTGCTTCTTAAAATATCTTTGCAGTCTTCAATTTTTGGCAATCTAGATCAGACCAAGCTC
AAAACCCGCTTTATTCTGAGGACTCCTGATATTTCCGTGATGCATCATGATGGAACACCT
GATCTCAGAATTGTGGCTGAAAAACTTGCAGATAACCTGAAGGTAATCTTCATCAGTAAA
TCCAGCATTGAACTGTATTCCCTCTATCCATTTTATGCACAATGA

Protein

375 aa

>Os05t0187100-01 Similar to Hexokinase.
MVAAAVAAAEQVVAALREECATPAARLDGVAAAMAGEMAAGLAEEGGSKIKMIVSYVDNL
PNGTEEGLFYALDLGGTNFRVLRVQLAGKEKRVVKRESREVSIPPHLMSGNSSELFGFIA
SALAKFVADEGHNAVFNDRQRELGFTFSFPVRQTSIASGTLIKWTKAFSIDDAVGEDVVA
ELQMAMEKQGLDMRVSALINDTVGTLAAGSYYDEDIVVGVILGTGSNAAYLEKANAIPKL
EGELPKSGNMVINTEWGNFSSSCLPITEYDEALDKESLNPGEQIFEKLISGMYLGEIVRR
VLLKISLQSSIFGNLDQTKLKTRFILRTPDISVMHHDGTPDLRIVAEKLADNLKVIFISK
SSIELYSLYPFYAQ*

5'UTR

chr05:5341022..5341148 (- strand) : 127 bp

CDS

chr05:5340834..5341021 (- strand) : 188 bp

chr05:5339484..5339634 (- strand) : 151 bp

chr05:5339164..5339343 (- strand) : 180 bp

chr05:5338909..5338983 (- strand) : 75 bp

chr05:5338661..5338816 (- strand) : 156 bp

chr05:5338458..5338556 (- strand) : 99 bp

chr05:5338220..5338350 (- strand) : 131 bp

chr05:5337856..5338000 (- strand) : 145 bp

3'UTR

chr05:5337333..5337855 (- strand) : 523 bp

FASTA

>Os05t0187100-01 class=Sequence position=chr05:5337333..5341148 (- strand)
AGAGACCTGT GTACGCGATC TTGGTTAGCT CCGGCCTTTG ATCTTGACCA CCAATCTCGC ATTTCTTGGA TCTTCTCGTC
TTCCTCACTC CTCGATCGAT CCATCGATTG GTTGCTGGTC GGAGACCATG GTGGCGGCGG CGGTGGCGGC GGCGGAGCAG
GTGGTGGCGG CGCTGCGGGA GGAGTGCGCG ACGCCGGCGG CGCGGCTGGA TGGGGTGGCG GCGGCGATGG CCGGCGAGAT
GGCGGCGGGG TTGGCGGAGG AGGGCGGCAG CAAGATCAAG ATGATCGTTT CCTACGTCGA CAACCTCCCC AATGGGTAAC
TAATTACTAC TAGTAATTAT ATTTATAATC ACTAATAATC ACAGGTCTTG TTTCCTTTTA ATTACTGTTT CATCATCCAC
TTCTTCTTTT AGCTCTCTCC TACTTGGAAA TTTCTTAGTA ATTGTGTGGT TCTTGGATGC CATGAACACT TTAATATCAG
CAGCTACAGA TGATTCGGAT ACTCTGATTG AAAATAAAAA TTGGTTTGTC AGGATTAATT TGCAAGCTGG TTTAATCTCC
TTTGGTTAAG TAGGTGGTGG TTAATTGCAT GATAATCACA TTTTTAGTAG GTGTTTTTTC TCCCAATTTG GTTTCATGTC
GGTTGGTAAC ATGAGCTATC GTTGGCTTGT TGCCACCTGC AGTGAGCTGC CAGTGACACA GCGTCGTGTG TCGGGGCCAA
GCAAATTGGG ATTAGATTAA ATTAAATTAA ATTAATCCCT AGAAGGCTAG AACATAATTT ACCTACTCTT TTTTTTTAAA
AAAAAGAAAA AGTTACCGCG CTCTTGCGTG TCCATGCGCG TGTCAAATTG CTCGCACTCG TGTCACCTGC TGCGGCAGCA
CGTGTGTGAC CCCGTGCAAC ATTGCGTGTC AGCGTGCGAG CGTGTAACCG TGTCTAGTTA CAGCTTGCCG ATGCCAAAAA
AAAAAAGGCA GAAAAGTTTT CTTGTTAAGA TCAGCAGAAA AGTTTTCTTT TATTTGTTGC GATTAGCAGG AAATTGTTTT
CTTGCTAAGC TCGCTGCCAA GACAGCATAA CTGCAGAGCA TCAATGCGTG TAGTGTTACT GCATTTCTGT AGATGCACCA
GCTGAGACTT TTCGTTTTTG TATGATTAGC GGAAAATATC TTTTGCTATT CTCGTTACTA AAACAACAGA ATAGTGGAAC
AGCAATGTGT GCGGTACTGT ATTTCTGCAT AAAAAGGTAA AAAAAAAGTT TCCATTTTTT TTAAAAAAAA ATCTGTAGTT
TGCAGAAAAA GGCTTTTTGT CAAGTTTGCT GCCAGAATGA CATAAATGCA GAACAACAAT GTGTTTATCA CTGCATTTCT
CCTTTTCTGT TTTTTTTTTT TTTGTGAATA GCAGAAAAGG GCTTAAGCAA AGCTATCTGC CAAAGCAACA AAATCGCAGA
ACAGCAATGT GTGTATTACT GTATTTTTCG TGATCAGCAT GACTAACAAC CTTTTGTTGT GCTAAATAAT GTAGGACCGA
AGAGGGCTTG TTCTACGCGC TGGATCTTGG GGGAACAAAC TTCCGAGTCC TGCGTGTGCA GCTTGCTGGA AAGGAGAAAC
GGGTCGTGAA GCGCGAGTCG AGGGAGGTCT CGATCCCTCC CCATCTCATG TCCGGCAACT CCTCGGTGAG TGAGCATGTC
CACACTTGTT TCCATATAGT ATCATAAGTT TTTGGGTGAA TTGGCTAGTA TATATCATAG TAAAACATCA CATTTAGTCT
CATTGGATGA CCATGTTTGT AATGTTGCTG TGATGCCAAT CTCAGGAGCT GTTTGGCTTC ATCGCTTCCG CGTTAGCCAA
GTTCGTCGCT GATGAAGGAC ATAATGCCGT GTTCAACGAC AGGCAAAGGG AACTGGGGTT CACCTTCTCT TTCCCTGTGC
GGCAAACATC GATTGCGTCT GGGACTCTTA TCAAGTGGAC CAAGGCGTTT TCTATTGATG ATGCTGTAAG AATTCTCTTG
ATTTGTCAGT TTTCCCACAT CACTGCATCA GTTGTTATCT AAAAAAACAA ATTCACAACA TCAATGTCAC AGCGAATCTG
TTTTTCACAT TGTTATGTGA AATGCTGTCA GAATTTTGTC ATTGGTTTCT TTTTCTGAAA TTAGTGCTTC TTTGGAATAT
GACAGGTAGG TGAAGATGTG GTGGCCGAAT TGCAGATGGC CATGGAGAAG CAAGGTCTGG ACATGCGCGT TTCCGCATTG
GTTAGTTCTG AAATGATCAG TTCCATATCA TTTTTGAACA AAGCGAAATT TGTTCTTATG ATAAGCTTGA CATTATTTTT
TGACTGTTTC AGATCAATGA CACTGTTGGG ACATTGGCGG CAGGCAGCTA CTACGACGAA GATATTGTCG TCGGTGTGAT
CTTAGGCACT GGCTCAAACG CCGCATATCT TGAGAAGGCA AATGCTATCC CTAAGTTGGA AGGCGAGTTA CCAAAATCAG
GAAACATGGT AAGGATTAGA TATTTCTCAA CCGAAGTAAC TGGCATGTAC TGCATAGAAT CATCTACTAT CTGTATTTGG
ATTTCTTTCT CACTGTACTT TCTGAATTTC AGGTTATTAA TACAGAATGG GGTAACTTCT CCTCATCCTG TCTTCCAATA
ACAGAATATG ATGAAGCACT AGATAAAGAG AGCTTAAACC CTGGAGAGCA GGCAAGTTTC TCTAGAAGAT TGCATACTCC
TCACATGTCA AAAGTTTTAC CCACATTATA TAGAACTGCT ACCTGTTGTC TAAAAAAACT ATGACTTGTT TTTTTCAGAT
CTTCGAGAAA TTGATTTCAG GAATGTATCT AGGTGAAATC GTAAGGAGAG TGCTTCTTAA AATATCTTTG CAGTCTTCAA
TTTTTGGCAA TCTAGATCAG ACCAAGCTCA AAACCCGCTT TATTCTGAGG TATATTTCTC GCTAAACTCA GTTGTGTGGT
AATCTTAATC TATAAGCTAG GCAAATAAAG CATGATTTGC TGAGAATATC TATAGGATCA CTTGGAGTTT CACCATTGAT
CCATAATAAT TATTAGGCGC AAAACATATG GCTTTGCAAT TTTCCAAAAT GAGATAAGCA ACTTTGAAAA AAGATGTGCT
GGCTTATCCT CTCTCTCATT ATATTCAGGA CTCCTGATAT TTCCGTGATG CATCATGATG GAACACCTGA TCTCAGAATT
GTGGCTGAAA AACTTGCAGA TAACCTGAAG GTAATCTTCA TCAGTAAATC CAGCATTGAA CTGTATTCCC TCTATCCATT
TTATGCACAA TGAACACATT ACACGGCATT GTCCACTTTT ACCACAGATC ACAGACACAT CCTTAGAAAC AAGGAAGATG
GTTGTCGAAA TCTGTGACAT CGTCACCCGA AGATCAGCCC GGCTGGCTGC TGCTGGGATC GTAGGGATCC TCAGGAAGAT
CGGCAGAGGC GTCCCAGGCG ACAAGCGAAA GTCGGTCATC GCCATCGATG GCGGTCTATA TGAACATTAC ACCGAATTCC
GGCAGTGCCT GGAGACCACG CTGACGGAGT TGCTCGGAGA AGAGGCGTCG AAGTCGGTGG CTGTCAAGCT TGCAAACGAC
GGGTCTGGCC TTGGAGCTGC CCTGATTGCA GCTGCTCATT CTCAGTACCT GAATTGATTC CCCATAGACA GAGTTCCAAC
TTTTATTAGT GACTCAGTGC TGTTGTTATA GTTTATAGAA TGTGGTGAAG TTCTGTATGT TTCGAAGGAG CCTGATGGAC
TCTACAAACA AAATTTTCAG AAATGAAATC GAAGCCAAAT GTGTTGGTGG TGTTGC