Os05t0427800-00

Locus

Os05g0427800

Description

Similar to Ribulose bisphosphate carboxylase large chain.

Transcript Evidence

ab initio prediction

Protein Evidence

Q37247 (UniProt)

CGSNL Gene Symbol

CGSNL Gene Name

CGSNL Gene Symbol Synonym(s)

CGSNL Gene Name Synonym(s)

Literature (PMID)

Manual Curation

Note

GO

Biological Process: carbon fixation (GO:0015977)

Molecular Function: magnesium ion binding (GO:0000287)

Molecular Function: ribulose-bisphosphate carboxylase activity (GO:0016984)

InterPro

Ribulose bisphosphate carboxylase, large subunit, ferrodoxin-like N-terminal (IPR017443)

Ribulose bisphosphate carboxylase, large subunit, N-terminal (IPR017444)

Transcript

447 bp

>Os05t0427800-00 Similar to Ribulose bisphosphate carboxylase large chain.
ATGTCACCACAAACAGAAACTAAAGCAAGTGTTGGATTTAAAGCTGGTGTTAAGGATTAT
AAATTGACTTACTACACCCCAGAGTACGAAACCAAGGACACTGATATCTTGGCAGCATTC
CGAATAACTCCTCAGCCGGGGGTTCCGCCCGAAGAAGCAGGGGCTGCAGTAGCTGCTGAA
TCTTCTACTGGTACATGGACAACTGTTTGGACTGATGGACTTACCAGTCTTGATCGTTAC
AAAGGCCGATGCTATCACATCGAGCCCGTTGTTGGGGAGGATAATCAATATATCGCTTAT
GTAGCTTATCCATTAGACCTATTTGAAGAGGGTTCCGTTACTAACATGTTTACTTCCATT
GTGGGTAACGTATTTGGTTTCAAAGCCCTACGCGCTCTACGTCTGGAGGATCTGCGAATT
CCCCTTACTTATTCAAAAACTTTCTAA

CDS

447 bp

>Os05t0427800-00 Similar to Ribulose bisphosphate carboxylase large chain.
ATGTCACCACAAACAGAAACTAAAGCAAGTGTTGGATTTAAAGCTGGTGTTAAGGATTAT
AAATTGACTTACTACACCCCAGAGTACGAAACCAAGGACACTGATATCTTGGCAGCATTC
CGAATAACTCCTCAGCCGGGGGTTCCGCCCGAAGAAGCAGGGGCTGCAGTAGCTGCTGAA
TCTTCTACTGGTACATGGACAACTGTTTGGACTGATGGACTTACCAGTCTTGATCGTTAC
AAAGGCCGATGCTATCACATCGAGCCCGTTGTTGGGGAGGATAATCAATATATCGCTTAT
GTAGCTTATCCATTAGACCTATTTGAAGAGGGTTCCGTTACTAACATGTTTACTTCCATT
GTGGGTAACGTATTTGGTTTCAAAGCCCTACGCGCTCTACGTCTGGAGGATCTGCGAATT
CCCCTTACTTATTCAAAAACTTTCTAA

Protein

149 aa

>Os05t0427800-00 Similar to Ribulose bisphosphate carboxylase large chain.
MSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDILAAFRITPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEDNQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPLTYSKTF*

CDS

chr05:20973884..20974330 (+ strand) : 447 bp

FASTA

>Os05t0427800-00 class=Sequence position=chr05:20973884..20974330 (+ strand)
ATGTCACCAC AAACAGAAAC TAAAGCAAGT GTTGGATTTA AAGCTGGTGT TAAGGATTAT AAATTGACTT ACTACACCCC
AGAGTACGAA ACCAAGGACA CTGATATCTT GGCAGCATTC CGAATAACTC CTCAGCCGGG GGTTCCGCCC GAAGAAGCAG
GGGCTGCAGT AGCTGCTGAA TCTTCTACTG GTACATGGAC AACTGTTTGG ACTGATGGAC TTACCAGTCT TGATCGTTAC
AAAGGCCGAT GCTATCACAT CGAGCCCGTT GTTGGGGAGG ATAATCAATA TATCGCTTAT GTAGCTTATC CATTAGACCT
ATTTGAAGAG GGTTCCGTTA CTAACATGTT TACTTCCATT GTGGGTAACG TATTTGGTTT CAAAGCCCTA CGCGCTCTAC
GTCTGGAGGA TCTGCGAATT CCCCTTACTT ATTCAAAAAC TTTCTAA