Os05t0522500-01

Locus

Os05g0522500

Description

Similar to Hexokinase 1 (EC 2.7.1.1).

Transcript Evidence

AK065207 (DDBJ, Best hit)

Protein Evidence

Q5W676 (UniProt)

CGSNL Gene Symbol

HXK5

CGSNL Gene Name

HEXOKINASE-5

CGSNL Gene Symbol Synonym(s)

OsHXK5

CGSNL Gene Name Synonym(s)

Hexokinase 5

Literature (PMID)

Manual Curation

Note

GO

Biological Process: carbohydrate metabolic process (GO:0005975)

Biological Process: glycolysis (GO:0006096)

Molecular Function: hexokinase activity (GO:0004396)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: phosphotransferase activity, alcohol group as acceptor (GO:0016773)

InterPro

Hexokinase (IPR001312)

Hexokinase, conserved site (IPR019807)

Hexokinase, N-terminal (IPR022672)

Hexokinase, C-terminal (IPR022673)

KEGG

Os05t0522500-01 (EC:2.7.1.1)

KOME

J013002F14 (Online Clone Ordering)

RiceXPro Database

AK065207

Oryzabase

9006

Plant Gene Family Database (PGFD)

Os05t0522500-01

Transcript

2031 bp

>Os05t0522500-01 Similar to Hexokinase 1 (EC 2.7.1.1).
CTTTCTCCTACGCGGCCGGAGAGAGGAGGGGGGAAGAGAGGATCTCGCAGAGCGCCATAG
CCTCGGATCCAGAAGCGGAATTCGGTGGAGGTCTCGGGCACCTGGATCGATCGGAGGAAG
GGAAGGCGGAGCAGCGGTGATGGGGAAGGCGGCGGCGGTGGGGACGGCGGTGGTGGTGGC
CGCGGCGGTCGGGGTGGCGGTGGTGCTGGCGCGGAGGCGGAGGAGGAGGGACCTGGAGCT
GGTGGAGGGAGCCGCGGCGGAGAGGAAGAGGAAGGTGGCGGCGGTGATCGAGGACGTGGA
GCACGCGCTGTCGACCCCGACGGCGCTGCTGCGGGGCATCTCGGACGCCATGGTCACCGA
GATGGAGCGAGGCCTGCGCGGGGACAGCCACGCCATGGTTAAGATGCTCATCACCTACGT
CGACAACCTCCCCACCGGAAATGAACAGGGGTTGTTTTATGCATTGGATCTTGGAGGAAC
CAACTTCCGCGTCCTGCGAGTCCAACTCGGTGGCAAGGAGAAACGTGTCGTCCAACAACA
GTACGAGGAAGTCTCAATTCCACCACATCTGATGGTTGGAACTTCCATGgaactgtttga
ttttattgcttctgcattgtcaaaatttgttgatactgaaggtgatgatttccacctccc
agaagggagacagagagagctgggcttcaccttttccttcccagtgagccagacatcaat
atcgtcaggaacgctcatcaagtggacaaagggtttctccatcaatGACGCGGTTGGCGA
AGATGTTGTATCTGAGTTGGGCAAGGCCATGGAGAGGCAGGGATTAGATATGAAAATTGC
AGCATTGGTTAATGACACTGTCGGCACATTGGCTGGTGGGAGGTATGCGGATAACAGTGT
TGTTGCTGCTATAATATTGGGCACTGGTACAAATGCAGCATATGTTGAGAATGCTAATGC
AATTCCTAAATGGACCGGTTTACTGCCTAGGTCCGGAAATATGGTAATCAACACAGAATG
GGGGAGCTTTAAATCAGATAAGCTTCCTCTTTCAGAATTCGATAAAGCAATGGATTTTGA
AAGCTTGAATCCTGGAGAGCAGATATATGAAAAGTTGATTTCTGGCATGTATCTTGGAGA
GATAGTGCGAAGAATCTTGCTGAAGCTTGCTCATGATGCAGCTTTGTTTGGGGATGTTGT
TCCATCTAAGCTAGAGCAACCGTTTGTACTAAGGACACCGGATATGTCAGCCATGCATCA
TGACTCGTCACATGACCTTAAAACTGTTGGAGCTAAGCTAAAGGATATCGTCGGGGTCCC
AGATACTTCCCTGGAAGTAAGATACATTACCAGTCACATTTGTGACATAGTTGCAGAGCG
TGCTGCACGCTTGGCTGCTGCTGGCATATATGGGGTCCTAAAGAAGCTAGGTCGGGACAA
GATGCCAAAAGACGGCAGTAAGATGCCTAGGACTGTCATTGCCTTGGATGGTGGGCTCTA
TGAACATTACAAGAAGTTCAGCAGTTGCTTAGAATCAACTCTAACAGACCTTCTTGGGGA
TGATGTCTCGTCTTCGGTGGTTACCAAGCTGGCCAACGATGGTTCTGGCATTGGAGCTGC
TCTTCTCGCAGCCTCGCACTCCCAGTATGCCGAGATCGACTAGCTTTAAGGATGATCTTG
ATGAATGATGAATCAAACTCCGTTTGTAGGTTCTCATTTCCCCCTTCAAAATCCACATAA
TACTCCTGGCTCCCCCCTTGAAATCTTACCATCTTTTTTTGGCTATTCTGAGGGCAAACA
TAAGTGCCTCTGCAGCGGGATATAGCTAGTATAGCGCCAATGAGTTTGGAGGTTTTCTAA
TGGCATAAAACGTTGGATGGCAGTAGCAGACTAACAGGGAAATGGAGGCACAGGCAATTT
CCATTCCTGTTCTGTCAGATTCTTTTCCCCCTTAATTGATGTTGAGAACCAAGATTTTTT
TGCTCTGTATTTTCTCTTCGTAATAAAGAAGGGGACATAATCTAATTGCTC

CDS

1524 bp

>Os05t0522500-01 Similar to Hexokinase 1 (EC 2.7.1.1).
ATGGGGAAGGCGGCGGCGGTGGGGACGGCGGTGGTGGTGGCCGCGGCGGTCGGGGTGGCG
GTGGTGCTGGCGCGGAGGCGGAGGAGGAGGGACCTGGAGCTGGTGGAGGGAGCCGCGGCG
GAGAGGAAGAGGAAGGTGGCGGCGGTGATCGAGGACGTGGAGCACGCGCTGTCGACCCCG
ACGGCGCTGCTGCGGGGCATCTCGGACGCCATGGTCACCGAGATGGAGCGAGGCCTGCGC
GGGGACAGCCACGCCATGGTTAAGATGCTCATCACCTACGTCGACAACCTCCCCACCGGA
AATGAACAGGGGTTGTTTTATGCATTGGATCTTGGAGGAACCAACTTCCGCGTCCTGCGA
GTCCAACTCGGTGGCAAGGAGAAACGTGTCGTCCAACAACAGTACGAGGAAGTCTCAATT
CCACCACATCTGATGGTTGGAACTTCCATGgaactgtttgattttattgcttctgcattg
tcaaaatttgttgatactgaaggtgatgatttccacctcccagaagggagacagagagag
ctgggcttcaccttttccttcccagtgagccagacatcaatatcgtcaggaacgctcatc
aagtggacaaagggtttctccatcaatGACGCGGTTGGCGAAGATGTTGTATCTGAGTTG
GGCAAGGCCATGGAGAGGCAGGGATTAGATATGAAAATTGCAGCATTGGTTAATGACACT
GTCGGCACATTGGCTGGTGGGAGGTATGCGGATAACAGTGTTGTTGCTGCTATAATATTG
GGCACTGGTACAAATGCAGCATATGTTGAGAATGCTAATGCAATTCCTAAATGGACCGGT
TTACTGCCTAGGTCCGGAAATATGGTAATCAACACAGAATGGGGGAGCTTTAAATCAGAT
AAGCTTCCTCTTTCAGAATTCGATAAAGCAATGGATTTTGAAAGCTTGAATCCTGGAGAG
CAGATATATGAAAAGTTGATTTCTGGCATGTATCTTGGAGAGATAGTGCGAAGAATCTTG
CTGAAGCTTGCTCATGATGCAGCTTTGTTTGGGGATGTTGTTCCATCTAAGCTAGAGCAA
CCGTTTGTACTAAGGACACCGGATATGTCAGCCATGCATCATGACTCGTCACATGACCTT
AAAACTGTTGGAGCTAAGCTAAAGGATATCGTCGGGGTCCCAGATACTTCCCTGGAAGTA
AGATACATTACCAGTCACATTTGTGACATAGTTGCAGAGCGTGCTGCACGCTTGGCTGCT
GCTGGCATATATGGGGTCCTAAAGAAGCTAGGTCGGGACAAGATGCCAAAAGACGGCAGT
AAGATGCCTAGGACTGTCATTGCCTTGGATGGTGGGCTCTATGAACATTACAAGAAGTTC
AGCAGTTGCTTAGAATCAACTCTAACAGACCTTCTTGGGGATGATGTCTCGTCTTCGGTG
GTTACCAAGCTGGCCAACGATGGTTCTGGCATTGGAGCTGCTCTTCTCGCAGCCTCGCAC
TCCCAGTATGCCGAGATCGACTAG

Protein

508 aa

>Os05t0522500-01 Similar to Hexokinase 1 (EC 2.7.1.1).
MGKAAAVGTAVVVAAAVGVAVVLARRRRRRDLELVEGAAAERKRKVAAVIEDVEHALSTP
TALLRGISDAMVTEMERGLRGDSHAMVKMLITYVDNLPTGNEQGLFYALDLGGTNFRVLR
VQLGGKEKRVVQQQYEEVSIPPHLMVGTSMELFDFIASALSKFVDTEGDDFHLPEGRQRE
LGFTFSFPVSQTSISSGTLIKWTKGFSINDAVGEDVVSELGKAMERQGLDMKIAALVNDT
VGTLAGGRYADNSVVAAIILGTGTNAAYVENANAIPKWTGLLPRSGNMVINTEWGSFKSD
KLPLSEFDKAMDFESLNPGEQIYEKLISGMYLGEIVRRILLKLAHDAALFGDVVPSKLEQ
PFVLRTPDMSAMHHDSSHDLKTVGAKLKDIVGVPDTSLEVRYITSHICDIVAERAARLAA
AGIYGVLKKLGRDKMPKDGSKMPRTVIALDGGLYEHYKKFSSCLESTLTDLLGDDVSSSV
VTKLANDGSGIGAALLAASHSQYAEID*

5'UTR

chr05:26017332..26017470 (+ strand) : 139 bp

CDS

chr05:26017471..26017769 (+ strand) : 299 bp

chr05:26019282..26019432 (+ strand) : 151 bp

chr05:26019516..26019698 (+ strand) : 183 bp

chr05:26020039..26020113 (+ strand) : 75 bp

chr05:26020284..26020439 (+ strand) : 156 bp

chr05:26020574..26020672 (+ strand) : 99 bp

chr05:26020756..26020886 (+ strand) : 131 bp

chr05:26021376..26021457 (+ strand) : 82 bp

chr05:26021550..26021897 (+ strand) : 348 bp

3'UTR

chr05:26021898..26022265 (+ strand) : 368 bp

FASTA

>Os05t0522500-01 class=Sequence position=chr05:26017332..26022265 (+ strand)
CTTTCTCCTA CGCGGCCGGA GAGAGGAGGG GGGAAGAGAG GATCTCGCAG AGCGCCATAG CCTCGGATCC AGAAGCGGAA
TTCGGTGGAG GTCTCGGGCA CCTGGATCGA TCGGAGGAAG GGAAGGCGGA GCAGCGGTGA TGGGGAAGGC GGCGGCGGTG
GGGACGGCGG TGGTGGTGGC CGCGGCGGTC GGGGTGGCGG TGGTGCTGGC GCGGAGGCGG AGGAGGAGGG ACCTGGAGCT
GGTGGAGGGA GCCGCGGCGG AGAGGAAGAG GAAGGTGGCG GCGGTGATCG AGGACGTGGA GCACGCGCTG TCGACCCCGA
CGGCGCTGCT GCGGGGCATC TCGGACGCCA TGGTCACCGA GATGGAGCGA GGCCTGCGCG GGGACAGCCA CGCCATGGTT
AAGATGCTCA TCACCTACGT CGACAACCTC CCCACCGGGT AAGCGCCTCG ATTCCGATCT GATGTCTGAT TCCTTTCGTT
TTTCGTATTA TGTTTCCTTT CGTTTTTAGT ATTATGGGTT TGGAACTTTG TGATCTAAAA AGTTTGGAAT TGGGAAAGGT
CTCGTATTGA TGCGAATCGT TCGGGAACAA ATCTAGTAGT GACGCGCGTA ACCGTGGGAA TTTATCTCCG TGCTCTGATT
AGGACCGACT GACCTTTTGA TGGGATGGTA GGAAATGTGC GAATTCTTTT TATGATGTTT GTACGAAAAT CAGATTCCCC
CGAAAATTGC GCCTAGTGGT GATCCGAAGA GAATGGAACT ATAATCTCCC ATTTGATCTT CATGTGGTTT TGGTGTCTCG
TATTCGTGAA TTGGGATTTT TTTTGTACGT TCCGATCGAA GCTAGATCAA TCCTAGCTTT GCCAAACAAT ATAAGCCATT
TGTTATAACT GAAATAAGTT ATGTAACCAC AAGGAAACGC TTGCTCTCGG ACTCTGCTGA GGAGAGCCAA GGCAAATTGG
CTCATACCAG TGATTGAAGG AAAAATGTGG AGTCGTGGGC ATCTGAAATT GCTTCTCATG CACCAGGACG CAGGATTTCG
GTGATGGGGG TACAGAGTTA CTAAAGCATC ATGCAATGAG AAAAAAAATG AAGTGCTAGT ATGTGTTATT AACACAAACA
TAAATCATTG TTATAGAAAA AAATATAAAG TAGCCAAGAG AAAATGATAA TACTCTTGAC AAGGATGATT TTTGTGCTTG
AAAATGATTG TTTTAATTTA GCTGATTGTG CATACACATA CTATACATAC ATGTTATAGA TTATAGATCA CATTTGTTTG
CTAAAACAAT TTGCGGGGTA CCGGATTACG AACTGTACCC CTCATGTCCT TGTGTAAACA GGATTCTACA TAGAACTCAA
ACAAGATAGA TAAATTGGCC TATCTAAGCT AGGAAAGATA GGTCTCCCGT CAACATATCC TATCGTTCTC AGATGATCTT
CGGTTTTGTG ATCTATAGTA GATCGTCCAT TTGTTCCTAA TTTGGCTCTT TAGGATTTCT GATTATGATA TGTGATTAAT
TAATTTGATC GTCCATTTGT TCCTACTTTG GCTCTTTAGG ATTTCTGATT ATGATATGTG ATTAATTAAT TTCTTGTTGG
TTTGATTTGT TAAGGCTTCA GTGACAGGTA ATTAACTAAT GTATGGCAGA GAGTTTCTTT GCATTGTGGT TTCCTTGTTA
GCAATCTGAC CAATTAGATC CATCAGTCGA GCTTATCTCA TGGTATAGTT GGTCTGGTAA TAAGTTTCTC TGTAACCTCC
ACATCGTTAA GCTAAATGTG GCAGGCACAT CCTGAAGGAA GTTTCTTAAA TATAATGATT CATTCTTATT CTATCGGATC
CTTCTACCAG TCTGTTAGAA CTCACTCACC CATAAGCATA CAATGTTTCC TGCTGCCTTC TTCCAAAAGT AGTAATTTCA
TTCTTTGATC ATAATGATTT CCCTTTGCAG AAATGAACAG GGGTTGTTTT ATGCATTGGA TCTTGGAGGA ACCAACTTCC
GCGTCCTGCG AGTCCAACTC GGTGGCAAGG AGAAACGTGT CGTCCAACAA CAGTACGAGG AAGTCTCAAT TCCACCACAT
CTGATGGTTG GAACTTCCAT GGTAAGCATT TGCTGCTTGA TTTTAAATTT CTTGGAGCTG TACATTCCAT GCTTGTCTTA
TGTATTTTCT GACTattaat gcaggaactg tttgatttta ttgcttctgc attgtcaaaa tttgttgata ctgaaggtga
tgatttccac ctcccagaag ggagacagag agagctgggc ttcacctttt ccttcccagt gagccagaca tcaatatcgt
caggaacgct catcaagtgg acaaagggtt tctccatcaa tGACGCGGTA AAAGTCAAAA ATAACTTTTG GACATACCCT
GACTAGAACA CAATCCTGAT CCTTCTTTAA ACACATGAAT TATGTCACAA GGTTCCTTGA TAAAGCTTGA TTGAATATGG
CAATGGAGTA TTTCAATTAG CTATTTGCTA CAATCTCCCT TTGTGTACAT TGTAATCAAC TTAACTAGGT TAGTGAAAAG
AAATATCGAC CTTGATCAGG AAGCATATTT AATTTGAGGA TCTTTAATAG TACTCAGTAT TATGTTTGCC TGGTTGATCA
TATCTGTGTG AACTGTCAAG CATCCAATAA GAATAATTTG ATTTTGCTAT ATTATCTCCT GAATTAGGTT GGCGAAGATG
TTGTATCTGA GTTGGGCAAG GCCATGGAGA GGCAGGGATT AGATATGAAA ATTGCAGCAT TGGTAAGTTA ATATATATTA
ATTTCGTCAA TTTCTTACTT CCACACTATA TCTATGCTCA GCTCCGTTAT CTGAGGCATT GATAATCATT TGTATCCTGA
TGCTGCTTTT GGGGTATTCA CATCTGATGA TGTGATGCAA ACATTGTTGA CATGATTTAC CACTGATGTT AGGTTAATGA
CACTGTCGGC ACATTGGCTG GTGGGAGGTA TGCGGATAAC AGTGTTGTTG CTGCTATAAT ATTGGGCACT GGTACAAATG
CAGCATATGT TGAGAATGCT AATGCAATTC CTAAATGGAC CGGTTTACTG CCTAGGTCCG GAAATATGGT TAGTGTGTGA
ATACCTTATG CTTGGGATTA TCATTAGTTG TCTATGTCTT ATAGATGATC AATGCCAACA CTCTTGAATG TTAACCCTAC
TTAAAAAAAT ATGTAAACGT GGAATTATTT GGTATTCTCT AGGTAATCAA CACAGAATGG GGGAGCTTTA AATCAGATAA
GCTTCCTCTT TCAGAATTCG ATAAAGCAAT GGATTTTGAA AGCTTGAATC CTGGAGAGCA GGTATTCTAT CCCCAGTATT
TTCCTCTCCT TTTAGTTTTA GCCTTTTAGG TGGACCGCAT TAACTTGTAT GTATTTTCCA ACAGATATAT GAAAAGTTGA
TTTCTGGCAT GTATCTTGGA GAGATAGTGC GAAGAATCTT GCTGAAGCTT GCTCATGATG CAGCTTTGTT TGGGGATGTT
GTTCCATCTA AGCTAGAGCA ACCGTTTGTA CTAAGGTATA TTTCTGTACC ATCTCTCTTT TGATCTTCAT TCCTTCCTTT
TGTCATGGCA AAAGCCGTTT TACTTTGTTG TTAACTATCA TGCTGGTCAA GTTTTTTTTT TCACGATTTC TGTGACTACC
CCTTGGATAA GAGTGCACAT GATATAAAGA CGTTGGCATC GTTTCCATTA TAATATTCGC ACTGTTGATA ATATACCCAG
ATAGATTATG GAAGGGGAAG TTGTTTGTAT ATCTTGAAAT TATCATGCTA AATCAGTTAG CAAATCCATG GAAGGTGACA
AACATACACT TTGTTGTTTT ATCCATTACT ACTTTCTTCT GGTTCTGGTT GATTCTCATA ATTGTGTGCA ACTAGAAGTT
ATCTAGCTTG GATAATTAGG GTGGTTTGGT TTTTGCTCAC CAGTTTTTCT TTATGCTTCT AACCCCTCAA TCTTATGCAA
CTCTGGTAGA ATTTTTTATA AGTATCTCAA TTGTTGTATC ACAGGACACC GGATATGTCA GCCATGCATC ATGACTCGTC
ACATGACCTT AAAACTGTTG GAGCTAAGCT AAAGGATATC GTCGGGGTAT GAAATTTCTT GACCCAAAGT GGATACGCAA
CATCCAACAC TGTTCAATGA GTACTGGTTG CTTATTTATG ATTTGATCTT TTATTCAGGT CCCAGATACT TCCCTGGAAG
TAAGATACAT TACCAGTCAC ATTTGTGACA TAGTTGCAGA GCGTGCTGCA CGCTTGGCTG CTGCTGGCAT ATATGGGGTC
CTAAAGAAGC TAGGTCGGGA CAAGATGCCA AAAGACGGCA GTAAGATGCC TAGGACTGTC ATTGCCTTGG ATGGTGGGCT
CTATGAACAT TACAAGAAGT TCAGCAGTTG CTTAGAATCA ACTCTAACAG ACCTTCTTGG GGATGATGTC TCGTCTTCGG
TGGTTACCAA GCTGGCCAAC GATGGTTCTG GCATTGGAGC TGCTCTTCTC GCAGCCTCGC ACTCCCAGTA TGCCGAGATC
GACTAGCTTT AAGGATGATC TTGATGAATG ATGAATCAAA CTCCGTTTGT AGGTTCTCAT TTCCCCCTTC AAAATCCACA
TAATACTCCT GGCTCCCCCC TTGAAATCTT ACCATCTTTT TTTGGCTATT CTGAGGGCAA ACATAAGTGC CTCTGCAGCG
GGATATAGCT AGTATAGCGC CAATGAGTTT GGAGGTTTTC TAATGGCATA AAACGTTGGA TGGCAGTAGC AGACTAACAG
GGAAATGGAG GCACAGGCAA TTTCCATTCC TGTTCTGTCA GATTCTTTTC CCCCTTAATT GATGTTGAGA ACCAAGATTT
TTTTGCTCTG TATTTTCTCT TCGTAATAAA GAAGGGGACA TAATCTAATT GCTC