Os06t0275500-01

Locus

Os06g0275500

Description

Similar to Polycomb protein EZ1 (Enhancer of zeste protein 1).

Transcript Evidence

AK111743 (DDBJ, Best hit)

Protein Evidence

E9JVC9 (UniProt)

CGSNL Gene Symbol

CLF

CGSNL Gene Name

CURLY LEAF

CGSNL Gene Symbol Synonym(s)

OsSET24, SDG711

CGSNL Gene Name Synonym(s)

SET protein 24

Literature (PMID)

Manual Curation

Note

GO

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

InterPro

SANT domain, DNA binding (IPR001005)

SET domain (IPR001214)

KEGG

Os06t0275500-01 (EC:2.1.1.43)

KOME

J023052J10 (Online Clone Ordering)

RiceXPro Database

AK111743

Oryzabase

8839

Plant Gene Family Database (PGFD)

Os06t0275500-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os06t0275500-01

Transcript

3207 bp

>Os06t0275500-01 Similar to Polycomb protein EZ1 (Enhancer of zeste protein 1).
CTTCCCTTTCCTCCACCCACGCCGCGACGACGAGTCGCCGCCGCGGCCTCGCCGGCGACC
AGGTCTCCGGCGGCCCCGCCGCCCGCCGTGACGGGGCTCCGGCCTTCCGCCCTCCTCCCC
GCACCGCCCGCTATCTCGGCTCCCCGACTCCTGCATTCCCCCGACTCTCCCCCGGCCGCC
GCCGCCGCCATTTCTGACTCTTTCTCCGCGGCGCGTCTCTCCTCCGAGAGCACGCCGACC
GCCTCCCGAAGCGGCGTCGCGGCCGCGGCGGCCGCCGCCTTCTCCCGCCCCTGATGGCTG
GCGATTCCCGAAATGAGCCGATGTTTTGCGAGGAAGGGAGCAGTGAATCGGGCTATGTTC
TATGTGTTATTGATTCGCTGAAGAAGAAAATCACATCGGACCGCTTTGTTTACATCCAGA
AAAGGGTAGAGGAGAATAGCATTAAGCTTAGCCCGATTACACTGCACTCTCACAATTTGT
CAAAAAATAGGCAAACTAGTACATCCAACAGTACAGATTTAGTCTCGAATTTGCTCACAA
AGAGGAAAGAAGATGCCCTGTGTGCTGTGAATAGTCGTGAGTCATCTCCTGATGAAAGTG
AAGGTGCCAATTGCCAAGATGAGTGTTCATCGACTGTTATTGTGGGTGGAAATCTATCCG
CGAGGAATTCTGTCCGTCCGATTAGACTACCAGAAGTGGCAACACTCCCTCCATATACAA
CTTGGATATTTTTGGACAGGAACCAGCGGATGCAAGAAGACCAATCTGTACTTGGTCGTC
GAAGGATTTACTATGATACAAACTGTGGCGAAGCTTTAATTTGCAGTGATAGTGAAGATG
AAGCTGTTGAGGACGAGGAAGAGAAAAAGGAGTTCAAGGATTCTGAAGATTGCATAATTC
GGATGACCATTCAAGAATGTGGCATGTCTGATGCTGTGCTTGAAACTCTAGCTCGAGATA
TCGAAAGGGCTCCTGATGATATAAAGGCCAGGTATGAGATCCTACAAGGGGAGAAACCTG
AGGGTTCTTCCAAGAAAGTGTCTGAACTTAATGTCAAAATGGAAGACGTGTACGGTGATA
AAGATCTGGATGCAGCATTGGATTCCTTTGACAATCTCTTTTGTCGCCGATGTTTGGTTT
TTGATTGCAAGCTACATGGGTGTTCTCAAGATTTAGTATTTCCGACTGAAAAGCAGGCAC
CATTGTGCAGCTCGGATGAGGGTACACCATGTGGTATTCACTGTTACAAACTGGTCTCTA
AACCAGATGCTATCATGGAGATTGATTCTCATTTGCTTGTTGATGTTGAGGAGCCAACAT
CGGACAATCTAAAGGATCAGATAGGGTCAAATAAGAAAAAGCTTGGTTCTAGTGGGCAGA
AAACAAAATCTCAACAAAGTGAAAGTTCTTCAACTGCAAGGGTTTCCTCAGAAAGCAGTG
AGTCTGAAGTACAACTGTTAAGCAATAAATCCCCGCAACACTCTCCTGGCCTCTCAAAAA
ATAAGCTTGGCGCAAAAGGTGGAATCAAGAAAAGTACTAACAGAAGAATTGCTGAGAGAA
TTCTAATGAGTGTGAAAAAGGGGCAACAGGAAATGTCACCGGACTCTAATTCTATTGTTA
ATGGATGCCATTGGCCTAGGGATATGAAGCTTAGATCTGATACTAGGAGTGGAATTAAGG
ATTCTGTTGTATCCTCACAGTGTAATTCTCCAAGCACAAGGAGTTTTAGAAAGAAGGGCA
CACTTCAAATGGAGAATAACTCATCTTTTGTGGATGCTCAGAGTGATTCAATGGAGGATA
CAAATAATGAACATTCAGCAACAGATGGTTGTGATAGTTCAAGGAAAGAGGAATGTGTTG
ATGAGAGTATATGCAGGCAAGAAGCTCATGGCAGGTCCTGGAAAGTGATTGAGCAAGGGC
TTCTATTGAAAGGATTAGAGATTTTTGGAAAGAACAGTTGTTTAATTGCTCGGAACCTTC
TGGGTGGGATGAAAACATGCACAGATGTTTTTCAGTATATGAATTACATTGAAAACAGCA
GTGCATCTGGAGCTCTTAGTGGTGTTGATTCTCTTGTTAAAGGATATATGAAGGGTAATG
AATTACGGACAAGATCAAGATTTGTGAGAAGGCGAGGAAGGGTCCGCCGTTTGAAGTACA
CCTGGAAAACTGCAGGCTACCATTTTATAAGGAAAAGGATTACAGAAAGGAAGGATCAGC
CTTGTCGACAATACACTCCTTGTGGTTGCCAGTCTGCATGTGGGAAGCAATGTCCATGTC
TCACAAATGGTACCTGCTGTGAGAAATACTGTGGGTGCCCGAAAATGTGCAAGAATCGCT
TCCGAGGTTGCCATTGCGCAAAGAGTCAGTGTCGCAGCCGGCAGTGTCCATGCTTTGCTG
CTGACAGGGAATGTGATCCTGATGTGTGTAGAAACTGCTGGGTAGGGTGCGGTGATGGTA
CATTGGGAGTCCCTAACCAAAGAGGTGATAATTATGAATGCCGGAACATGAAACTGCTGC
TTAAACAGCAACAAAGGGTCTTACTTGGGAGATCTGATGTTTCTGGCTGGGGAGCTTTCC
TCAAGAATAGTGTTGGGAAGCACGAGTATCTTGGCGAGTACACTGGGGAGCTTATCTCCC
ATAAAGAAGCTGACAAGCGTGGAAAGATATATGACCGTGAGAATTCATCGTTCCTTTTCA
ACTTGAACAATGAGTACGTTCTTGATGCCTACAGAATGGGCGACAAGCTGAAGTTCGCCA
ACCATTCCCCTGATCCAAACTGCTACGCCAAGGTCATCATGGTAGCAGGCGATCACAGGG
TGGGGATCTTCGCCAAAGAGCGGATCAGCGCGGGCGAGGAGCTGTTCTACGACTACCGCT
ACGAGCCCGACCGGGCCCCGGCGTGGGCTCGCAAGCCCGAGGGGCCCGGTGCCAAGGACG
ACGCCCAGCCTTCCACCGGGAGAGCAAAGAAGCTCGCCCACTGAAGAAGAAGAAGAAGAA
GAAGATCAGCCGTTGATTCTTTTGTTGTCTTGGTTGATTCTTTCGTTATTGGTGAGGGGG
ACCGAGAACTCTGACGGTGATTAGCGCCGTAAGGAAAACTTTCCTGCCATTCGTTGGCCC
CCTCGATTCGATTCGTTGATTTTCCCTGAATTCTGTAACTGCTGCACCTGTCGCCAGTTC
AACTTCAAAAGATTTTTCTGATTCTGG

CDS

2691 bp

>Os06t0275500-01 Similar to Polycomb protein EZ1 (Enhancer of zeste protein 1).
ATGGCTGGCGATTCCCGAAATGAGCCGATGTTTTGCGAGGAAGGGAGCAGTGAATCGGGC
TATGTTCTATGTGTTATTGATTCGCTGAAGAAGAAAATCACATCGGACCGCTTTGTTTAC
ATCCAGAAAAGGGTAGAGGAGAATAGCATTAAGCTTAGCCCGATTACACTGCACTCTCAC
AATTTGTCAAAAAATAGGCAAACTAGTACATCCAACAGTACAGATTTAGTCTCGAATTTG
CTCACAAAGAGGAAAGAAGATGCCCTGTGTGCTGTGAATAGTCGTGAGTCATCTCCTGAT
GAAAGTGAAGGTGCCAATTGCCAAGATGAGTGTTCATCGACTGTTATTGTGGGTGGAAAT
CTATCCGCGAGGAATTCTGTCCGTCCGATTAGACTACCAGAAGTGGCAACACTCCCTCCA
TATACAACTTGGATATTTTTGGACAGGAACCAGCGGATGCAAGAAGACCAATCTGTACTT
GGTCGTCGAAGGATTTACTATGATACAAACTGTGGCGAAGCTTTAATTTGCAGTGATAGT
GAAGATGAAGCTGTTGAGGACGAGGAAGAGAAAAAGGAGTTCAAGGATTCTGAAGATTGC
ATAATTCGGATGACCATTCAAGAATGTGGCATGTCTGATGCTGTGCTTGAAACTCTAGCT
CGAGATATCGAAAGGGCTCCTGATGATATAAAGGCCAGGTATGAGATCCTACAAGGGGAG
AAACCTGAGGGTTCTTCCAAGAAAGTGTCTGAACTTAATGTCAAAATGGAAGACGTGTAC
GGTGATAAAGATCTGGATGCAGCATTGGATTCCTTTGACAATCTCTTTTGTCGCCGATGT
TTGGTTTTTGATTGCAAGCTACATGGGTGTTCTCAAGATTTAGTATTTCCGACTGAAAAG
CAGGCACCATTGTGCAGCTCGGATGAGGGTACACCATGTGGTATTCACTGTTACAAACTG
GTCTCTAAACCAGATGCTATCATGGAGATTGATTCTCATTTGCTTGTTGATGTTGAGGAG
CCAACATCGGACAATCTAAAGGATCAGATAGGGTCAAATAAGAAAAAGCTTGGTTCTAGT
GGGCAGAAAACAAAATCTCAACAAAGTGAAAGTTCTTCAACTGCAAGGGTTTCCTCAGAA
AGCAGTGAGTCTGAAGTACAACTGTTAAGCAATAAATCCCCGCAACACTCTCCTGGCCTC
TCAAAAAATAAGCTTGGCGCAAAAGGTGGAATCAAGAAAAGTACTAACAGAAGAATTGCT
GAGAGAATTCTAATGAGTGTGAAAAAGGGGCAACAGGAAATGTCACCGGACTCTAATTCT
ATTGTTAATGGATGCCATTGGCCTAGGGATATGAAGCTTAGATCTGATACTAGGAGTGGA
ATTAAGGATTCTGTTGTATCCTCACAGTGTAATTCTCCAAGCACAAGGAGTTTTAGAAAG
AAGGGCACACTTCAAATGGAGAATAACTCATCTTTTGTGGATGCTCAGAGTGATTCAATG
GAGGATACAAATAATGAACATTCAGCAACAGATGGTTGTGATAGTTCAAGGAAAGAGGAA
TGTGTTGATGAGAGTATATGCAGGCAAGAAGCTCATGGCAGGTCCTGGAAAGTGATTGAG
CAAGGGCTTCTATTGAAAGGATTAGAGATTTTTGGAAAGAACAGTTGTTTAATTGCTCGG
AACCTTCTGGGTGGGATGAAAACATGCACAGATGTTTTTCAGTATATGAATTACATTGAA
AACAGCAGTGCATCTGGAGCTCTTAGTGGTGTTGATTCTCTTGTTAAAGGATATATGAAG
GGTAATGAATTACGGACAAGATCAAGATTTGTGAGAAGGCGAGGAAGGGTCCGCCGTTTG
AAGTACACCTGGAAAACTGCAGGCTACCATTTTATAAGGAAAAGGATTACAGAAAGGAAG
GATCAGCCTTGTCGACAATACACTCCTTGTGGTTGCCAGTCTGCATGTGGGAAGCAATGT
CCATGTCTCACAAATGGTACCTGCTGTGAGAAATACTGTGGGTGCCCGAAAATGTGCAAG
AATCGCTTCCGAGGTTGCCATTGCGCAAAGAGTCAGTGTCGCAGCCGGCAGTGTCCATGC
TTTGCTGCTGACAGGGAATGTGATCCTGATGTGTGTAGAAACTGCTGGGTAGGGTGCGGT
GATGGTACATTGGGAGTCCCTAACCAAAGAGGTGATAATTATGAATGCCGGAACATGAAA
CTGCTGCTTAAACAGCAACAAAGGGTCTTACTTGGGAGATCTGATGTTTCTGGCTGGGGA
GCTTTCCTCAAGAATAGTGTTGGGAAGCACGAGTATCTTGGCGAGTACACTGGGGAGCTT
ATCTCCCATAAAGAAGCTGACAAGCGTGGAAAGATATATGACCGTGAGAATTCATCGTTC
CTTTTCAACTTGAACAATGAGTACGTTCTTGATGCCTACAGAATGGGCGACAAGCTGAAG
TTCGCCAACCATTCCCCTGATCCAAACTGCTACGCCAAGGTCATCATGGTAGCAGGCGAT
CACAGGGTGGGGATCTTCGCCAAAGAGCGGATCAGCGCGGGCGAGGAGCTGTTCTACGAC
TACCGCTACGAGCCCGACCGGGCCCCGGCGTGGGCTCGCAAGCCCGAGGGGCCCGGTGCC
AAGGACGACGCCCAGCCTTCCACCGGGAGAGCAAAGAAGCTCGCCCACTGA

Protein

897 aa

>Os06t0275500-01 Similar to Polycomb protein EZ1 (Enhancer of zeste protein 1).
MAGDSRNEPMFCEEGSSESGYVLCVIDSLKKKITSDRFVYIQKRVEENSIKLSPITLHSH
NLSKNRQTSTSNSTDLVSNLLTKRKEDALCAVNSRESSPDESEGANCQDECSSTVIVGGN
LSARNSVRPIRLPEVATLPPYTTWIFLDRNQRMQEDQSVLGRRRIYYDTNCGEALICSDS
EDEAVEDEEEKKEFKDSEDCIIRMTIQECGMSDAVLETLARDIERAPDDIKARYEILQGE
KPEGSSKKVSELNVKMEDVYGDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEK
QAPLCSSDEGTPCGIHCYKLVSKPDAIMEIDSHLLVDVEEPTSDNLKDQIGSNKKKLGSS
GQKTKSQQSESSSTARVSSESSESEVQLLSNKSPQHSPGLSKNKLGAKGGIKKSTNRRIA
ERILMSVKKGQQEMSPDSNSIVNGCHWPRDMKLRSDTRSGIKDSVVSSQCNSPSTRSFRK
KGTLQMENNSSFVDAQSDSMEDTNNEHSATDGCDSSRKEECVDESICRQEAHGRSWKVIE
QGLLLKGLEIFGKNSCLIARNLLGGMKTCTDVFQYMNYIENSSASGALSGVDSLVKGYMK
GNELRTRSRFVRRRGRVRRLKYTWKTAGYHFIRKRITERKDQPCRQYTPCGCQSACGKQC
PCLTNGTCCEKYCGCPKMCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWVGCG
DGTLGVPNQRGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNSVGKHEYLGEYTGEL
ISHKEADKRGKIYDRENSSFLFNLNNEYVLDAYRMGDKLKFANHSPDPNCYAKVIMVAGD
HRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEGPGAKDDAQPSTGRAKKLAH*

5'UTR

chr06:9353713..9354005 (+ strand) : 293 bp

CDS

chr06:9354006..9354027 (+ strand) : 22 bp

chr06:9354128..9354231 (+ strand) : 104 bp

chr06:9354340..9354659 (+ strand) : 320 bp

chr06:9355450..9355611 (+ strand) : 162 bp

chr06:9356334..9356418 (+ strand) : 85 bp

chr06:9356535..9356684 (+ strand) : 150 bp

chr06:9356771..9356818 (+ strand) : 48 bp

chr06:9356888..9356956 (+ strand) : 69 bp

chr06:9357080..9357783 (+ strand) : 704 bp

chr06:9358609..9358744 (+ strand) : 136 bp

chr06:9358819..9359039 (+ strand) : 221 bp

chr06:9359538..9359669 (+ strand) : 132 bp

chr06:9360499..9360589 (+ strand) : 91 bp

chr06:9361061..9361108 (+ strand) : 48 bp

chr06:9361187..9361315 (+ strand) : 129 bp

chr06:9361540..9361809 (+ strand) : 270 bp

3'UTR

chr06:9361810..9362032 (+ strand) : 223 bp

FASTA

>Os06t0275500-01 class=Sequence position=chr06:9353713..9362032 (+ strand)
CTTCCCTTTC CTCCACCCAC GCCGCGACGA CGAGTCGCCG CCGCGGCCTC GCCGGCGACC AGGTCTCCGG CGGCCCCGCC
GCCCGCCGTG ACGGGGCTCC GGCCTTCCGC CCTCCTCCCC GCACCGCCCG CTATCTCGGC TCCCCGACTC CTGCATTCCC
CCGACTCTCC CCCGGCCGCC GCCGCCGCCA TTTCTGACTC TTTCTCCGCG GCGCGTCTCT CCTCCGAGAG CACGCCGACC
GCCTCCCGAA GCGGCGTCGC GGCCGCGGCG GCCGCCGCCT TCTCCCGCCC CTGATGGCTG GCGATTCCCG AAATGAGGCG
GGTTCTTTCT CCTTTGCCTT TTTTTACTGC TCGGATGAAA TTTGAATCTG TGTATGCTTG TGGTTGTGAT GAAATTTAGC
TTGTTCTGTC CCCGCAGCCG ATGTTTTGCG AGGAAGGGAG CAGTGAATCG GGCTATGTTC TATGTGTTAT TGATTCGCTG
AAGAAGAAAA TCACATCGGA CCGCTTTGTT TACATCCAGG TGATTTGATT TGATTTGATT GTTTGGAGCT GCAAATCTCG
GTCATTTTCT TGTATTTTCT TTATTTACCA GCTGATTAGT TTTGTTCCCC GTGATCTTTT TTTCCAGAAA AGGGTAGAGG
AGAATAGCAT TAAGCTTAGC CCGATTACAC TGCACTCTCA CAATTTGTCA AAAAATAGGC AAACTAGTAC ATCCAACAGT
ACAGATTTAG TCTCGAATTT GCTCACAAAG AGGAAAGAAG ATGCCCTGTG TGCTGTGAAT AGTCGTGAGT CATCTCCTGA
TGAAAGTGAA GGTGCCAATT GCCAAGATGA GTGTTCATCG ACTGTTATTG TGGGTGGAAA TCTATCCGCG AGGAATTCTG
TCCGTCCGAT TAGACTACCA GAAGTGGCAA CACTCCCTCC ATATACAACT TGGATATTTT TGGACAGGTG CATTTTCTTG
ACATCCCTAA GATCCCTGCT TAAATTACAT AGTTATCATG GAAAGTTATA GCGTATACAC TTTATTATCC ATTAGCAACA
ACATAGCAAT ACTATTTCAT TTCTCTTGCT AAACAGTAAA CACACGCTCA TTTGTGGTCT TTAGTTTTTT GTGCAACAAT
CTATTCAGTC AAACATAGTT TTTCCGACCT AATGCTTTAT GTCTCTGGTG ATTTTTTTTC TCTTCATGTG TAAATGTGTA
ATGGAGATAT TGCCTTTCGT TCTTACTATA AGCTTGGGAA ATGGTATAGT ATAAAAATGG AACAAGTCCT TATGCGGCCC
CTTGCTACGT GCCCCACCTC TCTCTTAATC ACATGCAGTT GCAGACTTGC AGGCTGGGAG TGTGTGTTAA AACAAGAGCA
GCAAATGCCA CATTGACTGC CTTGAATTCA TCTTCTTGGC TTTGGTAGCA AAGCTATTGT GCCAGAACCA TTGGCTTTGC
CTGCTGCAGT GTTTCTTTTG CTTTTGCTGT TTCATCCGCT TTATGCTTCT TAGTGTTCTC TTTGCTATTG CGTGATTTTG
TGGAGCAGCA AGCAAAAAAT CAGACTGAAA CATGTTTTTG ATGAATTGTT TGTTGATATG AATTTAACAG TATATCTCAT
ATGACAAACT TCTATTTTTC TAAATAAGTA ATGCAAAACA TGCATGGTCA CAGTTACAAT CCAGCATACT TTTAGTTTGG
AGAGGTAGGG CATCTTAAGG TTTGTTGAAA TATAAGATTT TACAATCTTT CGTGCAGGAA CCAGCGGATG CAAGAAGACC
AATCTGTACT TGGTCGTCGA AGGATTTACT ATGATACAAA CTGTGGCGAA GCTTTAATTT GCAGTGATAG TGAAGATGAA
GCTGTTGAGG ACGAGGAAGA GAAAAAGGAG TTCAAGGATT CTGAAGATTG CATAATTCGG TAAATATGCT TTGGACATGC
ATTTGTTTTC TTTTGCCTTG AACATTCACT AAGGATGCTC AACTTGTTTG ACCGTTACAG GCTCATGGGA CCAAGATACA
GGTGCAGTTA CCATAGCACC TGGAGCTTGG GCTCAGTCCA TAGAATAACA GATCTGATGA CTCTGTAGTA ATAGTTTCAT
GGAGAAATGC TTTCTTCTGT AAGCATTTTG TCATATTCTC TGTTTTTCTT TTGACTGGGA AAACTACCAG GACTTTGCCT
AGTAGTGTAA TTTCATTAAA GAATAAAAAA TAGTAATATT CTCTTTTTGA AGTCACAATA TAACATAGTA CAGAAGCAAT
AGAGAAATGA TATTAAATAT ACTGGTCAAG TAACATTTGG TATGAAATAT TCCCAAGAGA TTATTTAGTA AAACTACATT
ATTAAAAACT TGTAAGAAAA AGGGTTTGGT TTTGGGGCAT ATGTCTTATA TCATTAAATG AAATGGTCAT TACCAGTTTT
ATCTACATTG TTCCAGGGGA AAACCTTGAG CTGGTCACAC TGCATATTTG ACCTGGTTTT GTTTTGTGCA ACCCTTGCAC
AAGCAAGAAA AGTATGGTTA CAGCATTAAT CTGAGTTGTT TGTGGATTAA TTTAGACCTT AAACATCATA GATCACAATA
ATTTGGTTTC TCCTGTATGG AATTCTTCCA CTTAAGGGTG ATTTTGTGCA ATGATTGCCA GGATGACCAT TCAAGAATGT
GGCATGTCTG ATGCTGTGCT TGAAACTCTA GCTCGAGATA TCGAAAGGGC TCCTGATGAT ATAAAGGTTC ATACAACATT
TATTCAATCT CACGTCACAT TTGCATTTGA TCCATTTGGG ATTTTCCTCT TCCAACTTAT TGTTTCATTT CTGAAAAATT
AAATTACGTG TCTATTTTCC AGGCCAGGTA TGAGATCCTA CAAGGGGAGA AACCTGAGGG TTCTTCCAAG AAAGTGTCTG
AACTTAATGT CAAAATGGAA GACGTGTACG GTGATAAAGA TCTGGATGCA GCATTGGATT CCTTTGACAA TCTCTTTTGT
CGCCGATGTT TGGTACGTTT TCTGTTAATT GTCATGTGTG TTTTACATAA TATCTCTGGT TTACTGATGA AACATTCTGC
TCATTTTGAT GTTGGAAGGT TTTTGATTGC AAGCTACATG GGTGTTCTCA AGATTTAGTA TTTCCGGTAA TTTTCAAACC
AATGAGTTAT TTCCTAAACT TGTGTGTTGT TCTAATTAGT GTCCTTTTCG TATAGACTGA AAAGCAGGCA CCATTGTGCA
GCTCGGATGA GGGTACACCA TGTGGTATTC ACTGTTACAA ACTGGTCTGT ATTTTATAGG CATATGACTG TGGAAAAGCA
GCTCTTCTTT TATGATGATT TAGATATCCG AAACATAAGC ATATGCCGTT TTGCTGATCT TTACCTCATT TATAATCTTT
TTGTCAGGTC TCTAAACCAG ATGCTATCAT GGAGATTGAT TCTCATTTGC TTGTTGATGT TGAGGAGCCA ACATCGGACA
ATCTAAAGGA TCAGATAGGG TCAAATAAGA AAAAGCTTGG TTCTAGTGGG CAGAAAACAA AATCTCAACA AAGTGAAAGT
TCTTCAACTG CAAGGGTTTC CTCAGAAAGC AGTGAGTCTG AAGTACAACT GTTAAGCAAT AAATCCCCGC AACACTCTCC
TGGCCTCTCA AAAAATAAGC TTGGCGCAAA AGGTGGAATC AAGAAAAGTA CTAACAGAAG AATTGCTGAG AGAATTCTAA
TGAGTGTGAA AAAGGGGCAA CAGGAAATGT CACCGGACTC TAATTCTATT GTTAATGGAT GCCATTGGCC TAGGGATATG
AAGCTTAGAT CTGATACTAG GAGTGGAATT AAGGATTCTG TTGTATCCTC ACAGTGTAAT TCTCCAAGCA CAAGGAGTTT
TAGAAAGAAG GGCACACTTC AAATGGAGAA TAACTCATCT TTTGTGGATG CTCAGAGTGA TTCAATGGAG GATACAAATA
ATGAACATTC AGCAACAGAT GGTTGTGATA GTTCAAGGAA AGAGGAATGT GTTGATGAGA GTATATGCAG GCAAGAAGCT
CATGGCAGGT CCTGGAAAGT GATTGAGCAA GGGCTTCTAT TGAAAGGATT AGAGATTTTT GGAAAGAACA GGTTGGTCCC
TTGAAATGAT CAGCTTCATA TGAATTATTT CACTACCTTC TACTTCATCT TAATATTTGT ATACTATTGC ACAACTAACT
GCTGTATCTG TTCAGGACAG AGTAAACGTT AATGTGTCta atccctccgt cccaaaatat aaggcgtgct ttgactttta
attgtcaatt tctcacaagt atactgtcta tactctatag tggaaccaac atcatatgaa agtacattca aatatgaatc
tgacaatacc atttttatat cactaaacct atatattgtc agactagttg tgagtcaaga tttgtaaaat ttgaatttta
aaatgcgtgc acaccttata ttttggggtg gagggattaA CCTTTCAGTT CAGCACAAGA AACTGACTAT GCTTTCTTTT
AATATATCTG TATTACTAAA AGTATTCAAC ACAAATGTCT ATATTTAAAG CAAATGCTCT TGCATCATAA TTAGACATCC
CCGAAACTAT ATTCTTATAC TACTACATTT CAAGTAAAAG CTGTAACATG AAGATACAAT CTACAATTTG TCATGCATAA
CGTATTGGAA TGCGGAATTA ACTGGAATTT CTAATGTTTG CATCATTTAG TATCTAGTTG TGTTAGTTAT AGCGTTTCAT
GTACAAGAAA TTCTGATGTA TGTTCATTTC AAATGCCTTA AAAACTCATT CCTGTTTTCT TTGGATGTCT TGCAAGCATA
TTGGAAATGT TCTTTATCCT TTCTATAATG AGTAGAATAC CTTGTTTTCC CTAATTTGAA TAGTCATACT GAGCCCTTGT
TTTTCCTATG TTGAAGTTGT TTAATTGCTC GGAACCTTCT GGGTGGGATG AAAACATGCA CAGATGTTTT TCAGTATATG
AATTACATTG AAAACAGCAG TGCATCTGGA GCTCTTAGTG GTGTTGATTC TCTTGTTAAA GGATATATGA AGGTAGGATT
CATCATAAAG CTCATTTACT TGTATTTTCC CAAGGTTTCA TCTTACTTTA ATGCTTGAAC TCCCAGGGTA ATGAATTACG
GACAAGATCA AGATTTGTGA GAAGGCGAGG AAGGGTCCGC CGTTTGAAGT ACACCTGGAA AACTGCAGGC TACCATTTTA
TAAGGAAAAG GATTACAGAA AGGAAGGATC AGCCTTGTCG ACAATACACT CCTTGTGGTT GCCAGTCTGC ATGTGGGAAG
CAATGTCCAT GTCTCACAAA TGGTACCTGC TGTGAGAAAT ACTGTGGGTG AGCTACTTCA ATTATTCATA TTGCAGACTC
CGAGAACATT TTTTCTTCTA GATATTAATA ATGTTGCTTA TGAAAACAAA ACTGTGTAGA TGTATACAAT TTCAATATTG
TTTGGTTAGT GCCGACCAAT TATGTCGTAT GATCACATCT TAGTTTTGCA ATCATTGCTG CTTACTGAAA AGGAAAGGAA
AATAAAACCT AGGAGGAACT AGGCACCCTT TCAATTAAGA GGAAAACAGG CACCAAATTT CTAGTTGAAG AGGACTTGAA
CCTTGATGGT GGGAGAGTGA GGGTGTAAAC TCCGCATTTC TCACCCAAAT GGTGAATCAA ACACATGCTT CTCTTTTGTT
CTGTGTGCTC TTTTGGCTAT TAGCTATTAC TTATTTTGAT AATTTATAAT TTTAATTGGA ATAAATGATG CAAACACATG
GAGTGCAAAT GTTTGCTGTC CGCATCCTGC TGATGCAAGT TGAAGTAATC CTTTCTGCGT TGCAGGTGCC CGAAAATGTG
CAAGAATCGC TTCCGAGGTT GCCATTGCGC AAAGAGTCAG TGTCGCAGCC GGCAGTGTCC ATGCTTTGCT GCTGACAGGG
AATGTGATCC TGATGTGTGT AGAAACTGCT GGGTAGGGTA TGTATTTTAA ATTCTGATGA CCCTTTGAAT GATTTTGCTA
GTTAATGCAC ATTTGTATAT CTTAGAGAAA GGCACCAACT ATAATGTGCT TTTCATTCTT TGCACTTCTC CAACCTTACA
TCTACCTTGA AAGTTGAGAA ATTACCACCT ATGCCTGCAC TTGAAGGATG GAATTTTGAT GGATGATGGA TTTATCCTTA
AGTGCAGGAA GAATCTTGCA TATGTATATT CCAGTATCTG AAGATACGGA GTTCTGCAGT AAAATATCTT AATGGTAGAA
TTGAATTTAA TTAATATAAT CATATCAATT GCTTGCCCAA CAGTCCCAAT AGGCAATAGC TACATTCCAC AATTAAAAAA
ATGGTGCAAT AATAATAATT TGACATTTCC TTCTCATACC ATTTGCTAGC ATACTTGATA GTGTGTGCCA GCACATTGAC
AATTGATATT CTATATCTAA ATTATTTATA ACAATATCTG AGTTTTATAG GAGTGTTTAC CAGGAGTTAA TCCATGAAAA
ATGTATCAAT GATGGGGGAG TTTAATTTGA ATTTGTTATG AACGAGCTTC TAATGGTAGG AAATGAAATT TTAGATACTG
TAAGTTGTTA GGCAAACACC AAAGATGAGT ATATTATCCG GCCAGTGTGT AAATCCAATC ATGATCCTTT TTCACTCCAT
GGAACCTTAA ATATGCTTTC TGTTATTCAT TGTTGAAATA GTCTGTTATT CAATTTCAAT TACTGTTTCT TCATCCCTAA
TTTTTCTAGA ACAAAGCGCC AGTACATTGA ACTTCTATTT TTCTACCTGT ACTTTCTATT GTGCAGGTGC GGTGATGGTA
CATTGGGAGT CCCTAACCAA AGAGGTGATA ATTATGAATG CCGGAACATG AAACTGCTGC TTAAACAGCA ACAAAGGGTA
AACCTTTTGC ACTTTGATTT ATTCATGCTA TTGCACCTTG GTTATAATTT CGTCAAGCCT ATCGATTTTT TATGCCTGCT
TGGCCCTTCC ATTTGCCTTT ATTCGATGCT TTGATATTTT TGTGTGAGGA GGCTTGAGGT CTAAGTTAAT TACCCAGCAG
TACTTCTCAA TAGTTTTATT CTTTTTTTTT AATATTTTTC ACGTGAGTTC AAATTCCAGT TGTCTAAATA CAAAAGATCT
TAAGTTTAAT ACCAAAGAAA CTAGTTAGAG TAACTATATT CCAAAACAGG CAATGAACTA TGAACCAAAA AACTTCCCAT
TAGCAGGAAA ATAATTGCAT AAAGTATCTA TCGATTATGT TGGTGAATTT ATGAAACACC AGGGGGTGTT ACTTCATTTT
CTATTACAGG TCCTATTCCA TCTCTAAATA TCTGTAAATA GTATTGACTT GCTATGTGCA CTCTTCAGGT CTTACTTGGG
AGATCTGATG TTTCTGGCTG GGGAGCTTTC CTCAAGGTAA GATTTCTCTA TTGACCCTTT TCCTCCCTCA TAGGACGTAC
CCTCATCTAA CTAGTCCTTT TCCTAAATCT TCAGAATAGT GTTGGGAAGC ACGAGTATCT TGGCGAGTAC ACTGGGGAGC
TTATCTCCCA TAAAGAAGCT GACAAGCGTG GAAAGATATA TGACCGTGAG AATTCATCGT TCCTTTTCAA CTTGAACAAT
GAGGTGAGTG CAAAGACACC CCGCAAATTA CGGTCTGCAA GCATTCAGGA TTGCATACTG TACTGATTTG ACTAGCCTAA
TGTCATCCTT TTGCGTGAAC CGAGTTGTTT ACATCCCCAA CCCACTGTTG TTCAATATCG CGCGATTTAT GATCCGCTGC
AGTGTTTTCG CTGTTTTCGC CAGTACCGGA TGCTCACTCA CTCACTTTAC CCTCTCGATG AATGCAGTAC GTTCTTGATG
CCTACAGAAT GGGCGACAAG CTGAAGTTCG CCAACCATTC CCCTGATCCA AACTGCTACG CCAAGGTCAT CATGGTAGCA
GGCGATCACA GGGTGGGGAT CTTCGCCAAA GAGCGGATCA GCGCGGGCGA GGAGCTGTTC TACGACTACC GCTACGAGCC
CGACCGGGCC CCGGCGTGGG CTCGCAAGCC CGAGGGGCCC GGTGCCAAGG ACGACGCCCA GCCTTCCACC GGGAGAGCAA
AGAAGCTCGC CCACTGAAGA AGAAGAAGAA GAAGAAGATC AGCCGTTGAT TCTTTTGTTG TCTTGGTTGA TTCTTTCGTT
ATTGGTGAGG GGGACCGAGA ACTCTGACGG TGATTAGCGC CGTAAGGAAA ACTTTCCTGC CATTCGTTGG CCCCCTCGAT
TCGATTCGTT GATTTTCCCT GAATTCTGTA ACTGCTGCAC CTGTCGCCAG TTCAACTTCA AAAGATTTTT CTGATTCTGG