Os07t0435900-01

Locus

Os07g0435900

Description

SET domain containing protein.

Transcript Evidence

AK067172 (DDBJ, Best hit)

Protein Evidence

XP_002315593.1 (RefSeq)

CGSNL Gene Symbol

_

CGSNL Gene Name

_

CGSNL Gene Symbol Synonym(s)

OsSET25, SDG726, OsSUVH2

CGSNL Gene Name Synonym(s)

SET protein 25, SUVH Histone Methyltransferase 2

Literature (PMID)

Manual Curation

Note

GO

Biological Process: histone lysine methylation (GO:0034968)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: histone-lysine N-methyltransferase activity (GO:0018024)

Molecular Function: histone binding (GO:0042393)

InterPro

SET domain (IPR001214)

SRA-YDG (IPR003105)

Pre-SET domain (IPR007728)

KEGG

Os07t0435900-01

KOME

J013097K17 (Online Clone Ordering)

RiceXPro Database

AK067172

Oryzabase

13389

Plant Gene Family Database (PGFD)

Os07t0435900-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os07t0435900-01

Transcript

2787 bp

>Os07t0435900-01 SET domain containing protein.
ACTTATTTTTTTACTTTTCGGTGAAGCCCGGGAAAAAGGGCGCTCCATTTCGGAGATTTC
GCACTTCCCACCCCTTCCCTTCGCTTCCTCCCTCCCTCGCCTCCGCCTCATCGCCGATTC
AACCGATTCGCCATCGCCCCCCACCTCGCCGCCGTCGCCGCCGCCGCCTCGTAAACCGGT
GGGATTTTGCGGGGAGGAGGGAGTTTGGTGCGGGAGAAGGGGGCGGAGGAGTGGGTGGTT
TTGTTTTTTTTTTTTTTGTATTTTGTTTTTGTGTGTGAGAGAGGGGGGAAGGGGGCAATG
GAGATGGACACATCGCCATCGTCTTCGGCGCCGTCGTCGCCGGCGGCGTCGTCGGACTCC
ATCGACCTCAACTTCCTGCCGTTCCTCAAGAGGGAGCCCAAGTCGGAGCCGGCTTCACCG
GAGCGAGGGCCTCTGCCGCTGCCGGCAGCGGCACCGCCGCCTCCACCTCCGCCGCCGCCC
CCACCACCGCCACCGCAGGTGCAGGCGGCGACGGTGGCAACTCCGGTGCCGGCGACGCCC
GACCTCTCGGCGGCGGCGGTGATGACGCCGCTGCAGTCGCTGCCGCCGAACCCCGAGGAG
GAGACGCTCCTGGCGGAGTACTACCGGCTCGCGACGCTATACCTGTCGTCGGCGGGGGCG
GCCGGCGTAATCGTGCCGGCGGCGGCGCCGGAGGCCTCCGCGGGGGCGGTGGCGCAGCCC
GGGTCGGGGTCCGGCGCGAAGAAGCGGCGGCCGCGGTCGTCGGAGCTGGTGCGGGTGTCC
TCGCTGAGCGTGCAGGACCAGATCTACTTCCGGGACCTGGTGCGCCGGGCGCGCATCACG
TTCGAGTCTCTCCGCGGGATCCTGCTGCGGGACGACGAGCGCGCGGAGGTGCTCGGCCTC
ACGGGCGTCCCCGGGTTCGGCGCCGTCGACCGCCGCCGCGTCCGCGCCGACCTGCGTGCC
GCGGCGCTGATGGGGGACCGAGACCTGTGGCTCAACCGCGACCGCCGAATCGTGGGGCCG
ATCCCGGGGATCTCGGTTGGGGACGCCTTCTTCTTCCGCATGGAGCTTTGCGTGCTAGGG
CTACACGGCCAGGTGCAGGCTGGGATCGACTTTGTCACGGCTGGGCAGTCTTCCTCAGGG
GAGCCCATAGCCACATCTATCATCGTGTCCGGTGGGTATGAAGACGATGACGATCGCGGC
GATGTACTTGTGTACACAGGACATGGTGGTCGTGACCCCAACCTCCACAAGCATTGTGTT
GATCAGAAGCTTGAGGGTGGCAACCTTGCCCTCGAGCGTAGcatggcctatggtattgag
atccgcgtgatccgtgctgtcaagtccaagcgcagccccgtcggcaaggtaTACTTCTAt
gatggcctctataaggttgttgactactggcttgaccgtgggaagtctggcttcggtgtt
tacaagtacaaaatgctgcgcatcgaggggcaggagtcgatgggctctgtaaattttcga
ctagccgaacagcTTAAGGTCAATGCCCTGACTTTCCGGCCAACAGGGTATTTGGGCTTT
GATATTTCCATGGGTCGAGAGATCATGCCGGTTGCACTGTACAATGATGTTGATGATGAT
CGTGACCCACTTTTATTTGAGTATCTGGCGCGGCCAATATTTCCGTCCTCTGCAGTCCAA
GGGAAGTTTGCTGAGGGTGGTGGCGGGTGTGAGTGCACTGAGAATTGCTCAATTGGATGT
TACTGTGCACAGAGGAATGGCGGTGAGTTTGCATATGACAAGCTCGGTGCTCTTTTACGG
GGCAAACCACTGGTATATGAGTGTGGGCCATATTGCCGGTGCCCACCTAGTTGCCCCAAC
AGGGTTAGTCAGAAGGGGCTTAGGAATCGGCTTGAGGTATTCCGGTCAAGGGAGACTGGG
TGGGGTGTTCGGTCTTTGGATCTCATTAAGGCTGGAACCTTCATCTGTGAGTTTAGTGGG
ATAGTGCTCACTCATCAACAGTCAGAGATTATGGCTGCGAATGGTGATTGCTTGGTGCGG
CCAAGCAGGTTCCCTCCAAGGTGGTTAGATTGGGGTGATGTCTCTGATGTCTATCCAGAG
TATGTGGCACCAAACAATCCAGCTGTTCCTGACTTGAAATTTTCAATTGATGTGTCAAGG
GCAAGGAATGTGGCTTGTTATTTCAGCCATAGTTGCAGTCCAAATGTGTTTGTCCAGTTT
GTGCTGTTTGACCATTACAACGCAGCTTATCCTCACCTCATGATCTTTGCCATGGAGAAC
ATTCCACCATTGAGGGAGCTAAGCATTGACTATGGAATGATTGATGAATGGGTGGGAAAG
TTAACCATGTAGTCAGGCTGTCTACTAGAAGGCAATACTCAGTTTATCTTCCTTTGTTTT
GATGCTTTCATAATCCTTCTCATGGAGATTTTTGAGGTGATTGCTGACAACAAGTTTCTC
TGATGGCGAATAACAGAAGCTTGCATATGGGATGATGTTTCAAGCCTTCCCATGAGGAAG
GCAAAGTCACAGCTCATTGTCATCCACTAGGCATCAACCGTCCGTTGTATATTTTTGCAT
GGTAGCTGCAGTGCCCCGTGGCTGATTCCCTCTCACCCTTGAAGCTTGATGCTTGCTTTT
GTAGGAAGCTTGTTTTGCGCAGCAAGCACCGAGTTTCATACTTGACCTCTGTTTTTCTTT
TTTTTTCCCTTCAATTGCTACGAGAACTCCATATGTACATATATCTGTACATTACATGAC
TTCAAAATGTGTCCCACTTCTGTCTGT

CDS

2055 bp

>Os07t0435900-01 SET domain containing protein.
ATGGAGATGGACACATCGCCATCGTCTTCGGCGCCGTCGTCGCCGGCGGCGTCGTCGGAC
TCCATCGACCTCAACTTCCTGCCGTTCCTCAAGAGGGAGCCCAAGTCGGAGCCGGCTTCA
CCGGAGCGAGGGCCTCTGCCGCTGCCGGCAGCGGCACCGCCGCCTCCACCTCCGCCGCCG
CCCCCACCACCGCCACCGCAGGTGCAGGCGGCGACGGTGGCAACTCCGGTGCCGGCGACG
CCCGACCTCTCGGCGGCGGCGGTGATGACGCCGCTGCAGTCGCTGCCGCCGAACCCCGAG
GAGGAGACGCTCCTGGCGGAGTACTACCGGCTCGCGACGCTATACCTGTCGTCGGCGGGG
GCGGCCGGCGTAATCGTGCCGGCGGCGGCGCCGGAGGCCTCCGCGGGGGCGGTGGCGCAG
CCCGGGTCGGGGTCCGGCGCGAAGAAGCGGCGGCCGCGGTCGTCGGAGCTGGTGCGGGTG
TCCTCGCTGAGCGTGCAGGACCAGATCTACTTCCGGGACCTGGTGCGCCGGGCGCGCATC
ACGTTCGAGTCTCTCCGCGGGATCCTGCTGCGGGACGACGAGCGCGCGGAGGTGCTCGGC
CTCACGGGCGTCCCCGGGTTCGGCGCCGTCGACCGCCGCCGCGTCCGCGCCGACCTGCGT
GCCGCGGCGCTGATGGGGGACCGAGACCTGTGGCTCAACCGCGACCGCCGAATCGTGGGG
CCGATCCCGGGGATCTCGGTTGGGGACGCCTTCTTCTTCCGCATGGAGCTTTGCGTGCTA
GGGCTACACGGCCAGGTGCAGGCTGGGATCGACTTTGTCACGGCTGGGCAGTCTTCCTCA
GGGGAGCCCATAGCCACATCTATCATCGTGTCCGGTGGGTATGAAGACGATGACGATCGC
GGCGATGTACTTGTGTACACAGGACATGGTGGTCGTGACCCCAACCTCCACAAGCATTGT
GTTGATCAGAAGCTTGAGGGTGGCAACCTTGCCCTCGAGCGTAGcatggcctatggtatt
gagatccgcgtgatccgtgctgtcaagtccaagcgcagccccgtcggcaaggtaTACTTC
TAtgatggcctctataaggttgttgactactggcttgaccgtgggaagtctggcttcggt
gtttacaagtacaaaatgctgcgcatcgaggggcaggagtcgatgggctctgtaaatttt
cgactagccgaacagcTTAAGGTCAATGCCCTGACTTTCCGGCCAACAGGGTATTTGGGC
TTTGATATTTCCATGGGTCGAGAGATCATGCCGGTTGCACTGTACAATGATGTTGATGAT
GATCGTGACCCACTTTTATTTGAGTATCTGGCGCGGCCAATATTTCCGTCCTCTGCAGTC
CAAGGGAAGTTTGCTGAGGGTGGTGGCGGGTGTGAGTGCACTGAGAATTGCTCAATTGGA
TGTTACTGTGCACAGAGGAATGGCGGTGAGTTTGCATATGACAAGCTCGGTGCTCTTTTA
CGGGGCAAACCACTGGTATATGAGTGTGGGCCATATTGCCGGTGCCCACCTAGTTGCCCC
AACAGGGTTAGTCAGAAGGGGCTTAGGAATCGGCTTGAGGTATTCCGGTCAAGGGAGACT
GGGTGGGGTGTTCGGTCTTTGGATCTCATTAAGGCTGGAACCTTCATCTGTGAGTTTAGT
GGGATAGTGCTCACTCATCAACAGTCAGAGATTATGGCTGCGAATGGTGATTGCTTGGTG
CGGCCAAGCAGGTTCCCTCCAAGGTGGTTAGATTGGGGTGATGTCTCTGATGTCTATCCA
GAGTATGTGGCACCAAACAATCCAGCTGTTCCTGACTTGAAATTTTCAATTGATGTGTCA
AGGGCAAGGAATGTGGCTTGTTATTTCAGCCATAGTTGCAGTCCAAATGTGTTTGTCCAG
TTTGTGCTGTTTGACCATTACAACGCAGCTTATCCTCACCTCATGATCTTTGCCATGGAG
AACATTCCACCATTGAGGGAGCTAAGCATTGACTATGGAATGATTGATGAATGGGTGGGA
AAGTTAACCATGTAG

Protein

685 aa

>Os07t0435900-01 SET domain containing protein.
MEMDTSPSSSAPSSPAASSDSIDLNFLPFLKREPKSEPASPERGPLPLPAAAPPPPPPPP
PPPPPPQVQAATVATPVPATPDLSAAAVMTPLQSLPPNPEEETLLAEYYRLATLYLSSAG
AAGVIVPAAAPEASAGAVAQPGSGSGAKKRRPRSSELVRVSSLSVQDQIYFRDLVRRARI
TFESLRGILLRDDERAEVLGLTGVPGFGAVDRRRVRADLRAAALMGDRDLWLNRDRRIVG
PIPGISVGDAFFFRMELCVLGLHGQVQAGIDFVTAGQSSSGEPIATSIIVSGGYEDDDDR
GDVLVYTGHGGRDPNLHKHCVDQKLEGGNLALERSMAYGIEIRVIRAVKSKRSPVGKVYF
YDGLYKVVDYWLDRGKSGFGVYKYKMLRIEGQESMGSVNFRLAEQLKVNALTFRPTGYLG
FDISMGREIMPVALYNDVDDDRDPLLFEYLARPIFPSSAVQGKFAEGGGGCECTENCSIG
CYCAQRNGGEFAYDKLGALLRGKPLVYECGPYCRCPPSCPNRVSQKGLRNRLEVFRSRET
GWGVRSLDLIKAGTFICEFSGIVLTHQQSEIMAANGDCLVRPSRFPPRWLDWGDVSDVYP
EYVAPNNPAVPDLKFSIDVSRARNVACYFSHSCSPNVFVQFVLFDHYNAAYPHLMIFAME
NIPPLRELSIDYGMIDEWVGKLTM*

5'UTR

chr07:14563261..14563557 (+ strand) : 297 bp

CDS

chr07:14563558..14565612 (+ strand) : 2055 bp

3'UTR

chr07:14565613..14565725 (+ strand) : 113 bp

chr07:14569683..14570004 (+ strand) : 322 bp

FASTA

>Os07t0435900-01 class=Sequence position=chr07:14563261..14570004 (+ strand)
ACTTATTTTT TTACTTTTCG GTGAAGCCCG GGAAAAAGGG CGCTCCATTT CGGAGATTTC GCACTTCCCA CCCCTTCCCT
TCGCTTCCTC CCTCCCTCGC CTCCGCCTCA TCGCCGATTC AACCGATTCG CCATCGCCCC CCACCTCGCC GCCGTCGCCG
CCGCCGCCTC GTAAACCGGT GGGATTTTGC GGGGAGGAGG GAGTTTGGTG CGGGAGAAGG GGGCGGAGGA GTGGGTGGTT
TTGTTTTTTT TTTTTTTGTA TTTTGTTTTT GTGTGTGAGA GAGGGGGGAA GGGGGCAATG GAGATGGACA CATCGCCATC
GTCTTCGGCG CCGTCGTCGC CGGCGGCGTC GTCGGACTCC ATCGACCTCA ACTTCCTGCC GTTCCTCAAG AGGGAGCCCA
AGTCGGAGCC GGCTTCACCG GAGCGAGGGC CTCTGCCGCT GCCGGCAGCG GCACCGCCGC CTCCACCTCC GCCGCCGCCC
CCACCACCGC CACCGCAGGT GCAGGCGGCG ACGGTGGCAA CTCCGGTGCC GGCGACGCCC GACCTCTCGG CGGCGGCGGT
GATGACGCCG CTGCAGTCGC TGCCGCCGAA CCCCGAGGAG GAGACGCTCC TGGCGGAGTA CTACCGGCTC GCGACGCTAT
ACCTGTCGTC GGCGGGGGCG GCCGGCGTAA TCGTGCCGGC GGCGGCGCCG GAGGCCTCCG CGGGGGCGGT GGCGCAGCCC
GGGTCGGGGT CCGGCGCGAA GAAGCGGCGG CCGCGGTCGT CGGAGCTGGT GCGGGTGTCC TCGCTGAGCG TGCAGGACCA
GATCTACTTC CGGGACCTGG TGCGCCGGGC GCGCATCACG TTCGAGTCTC TCCGCGGGAT CCTGCTGCGG GACGACGAGC
GCGCGGAGGT GCTCGGCCTC ACGGGCGTCC CCGGGTTCGG CGCCGTCGAC CGCCGCCGCG TCCGCGCCGA CCTGCGTGCC
GCGGCGCTGA TGGGGGACCG AGACCTGTGG CTCAACCGCG ACCGCCGAAT CGTGGGGCCG ATCCCGGGGA TCTCGGTTGG
GGACGCCTTC TTCTTCCGCA TGGAGCTTTG CGTGCTAGGG CTACACGGCC AGGTGCAGGC TGGGATCGAC TTTGTCACGG
CTGGGCAGTC TTCCTCAGGG GAGCCCATAG CCACATCTAT CATCGTGTCC GGTGGGTATG AAGACGATGA CGATCGCGGC
GATGTACTTG TGTACACAGG ACATGGTGGT CGTGACCCCA ACCTCCACAA GCATTGTGTT GATCAGAAGC TTGAGGGTGG
CAACCTTGCC CTCGAGCGTA Gcatggccta tggtattgag atccgcgtga tccgtgctgt caagtccaag cgcagccccg
tcggcaaggt aTACTTCTAt gatggcctct ataaggttgt tgactactgg cttgaccgtg ggaagtctgg cttcggtgtt
tacaagtaca aaatgctgcg catcgagggg caggagtcga tgggctctgt aaattttcga ctagccgaac agcTTAAGGT
CAATGCCCTG ACTTTCCGGC CAACAGGGTA TTTGGGCTTT GATATTTCCA TGGGTCGAGA GATCATGCCG GTTGCACTGT
ACAATGATGT TGATGATGAT CGTGACCCAC TTTTATTTGA GTATCTGGCG CGGCCAATAT TTCCGTCCTC TGCAGTCCAA
GGGAAGTTTG CTGAGGGTGG TGGCGGGTGT GAGTGCACTG AGAATTGCTC AATTGGATGT TACTGTGCAC AGAGGAATGG
CGGTGAGTTT GCATATGACA AGCTCGGTGC TCTTTTACGG GGCAAACCAC TGGTATATGA GTGTGGGCCA TATTGCCGGT
GCCCACCTAG TTGCCCCAAC AGGGTTAGTC AGAAGGGGCT TAGGAATCGG CTTGAGGTAT TCCGGTCAAG GGAGACTGGG
TGGGGTGTTC GGTCTTTGGA TCTCATTAAG GCTGGAACCT TCATCTGTGA GTTTAGTGGG ATAGTGCTCA CTCATCAACA
GTCAGAGATT ATGGCTGCGA ATGGTGATTG CTTGGTGCGG CCAAGCAGGT TCCCTCCAAG GTGGTTAGAT TGGGGTGATG
TCTCTGATGT CTATCCAGAG TATGTGGCAC CAAACAATCC AGCTGTTCCT GACTTGAAAT TTTCAATTGA TGTGTCAAGG
GCAAGGAATG TGGCTTGTTA TTTCAGCCAT AGTTGCAGTC CAAATGTGTT TGTCCAGTTT GTGCTGTTTG ACCATTACAA
CGCAGCTTAT CCTCACCTCA TGATCTTTGC CATGGAGAAC ATTCCACCAT TGAGGGAGCT AAGCATTGAC TATGGAATGA
TTGATGAATG GGTGGGAAAG TTAACCATGT AGTCAGGCTG TCTACTAGAA GGCAATACTC AGTTTATCTT CCTTTGTTTT
GATGCTTTCA TAATCCTTCT CATGGAGATT TTTGAGGTGA TTGCTGACAA CAAGTTTCTC TGATGGTAAC TCTCCCAGTC
CTTCCATGAT CTTTTTATTT TGAGATTTCT AGGATTATGT TTCGAACTCA GTACTTATAA TATGCCTTTA TAACAAGTCT
ACATTACTTG TGTGTGAATT GCTTCAATTT GCATTTTCTG TACCTCCTTT TGATTGACCT GTATTACTTC CTACTTAATT
AGTATTTTGT TTATCTCTTG CTTATTCAAC TTCATTGCAT TTTTCAATGC TGGGATCATG ATTCATAAAT TGGTTGTGGT
ACTTGAAAAG ATTGAATGAA GTAATGAATT GGTTAAAGTG CAGCCTTGTG AAGTAGTGCT CCTGGGTGCA TGCGTTCCTT
GCCCTCTATA AATAGGCAAC AATCTCCATA CATATGTACC ATAAATGTTA TCTTTGATTT ACTAGTCTTC ATTTCTTTCA
GTCAGAAATA TTTGGATTTT ATCGTACTAT TGGTGGTCAG CTGCTGATAT GTGCTGTTCA AAAAAAAAAA ACTAGTGGTT
TCAAAATTTA GTTTGAAATT AAATATCTTA TACCAATTAT CATGATGATT TCTGGGGATA TTGTTCTTCA GCCTGGCTTA
TGTTAGAATA TCAATTATAT ATTGTTACAT TTTTTTGCAT CGTTTCTGGA ATCTGGAGGT CAATCTAGCC CATATATGGT
AATACGTGCC CATATAATTC CCCAACGAGC TTTATGGTTG TTAAGTAGTA AAGTTGAGTC AAGTTGCCCC TCTACCGACT
TGAGAGTTGA CACTAGTCTT TGGTAGTATA TCTGACTTTT ACTACATTTA CTGGTTGCTT CTACCACTCG TCTTGCACTA
CATGCTGTGC TGATGGACCT AATGGAACTC TTTTCTTATC TCCCTTCATT CAGTAATAAT GGGCCTGACA GACCAAGCCT
CCTAAGCAAC TCATCGTTGC TGCCTTGCTT CATTGTGTCT TCTACTGCCA ACAACTTCTT GTGCCCTCAA GTCATCCTCT
CTGGCCAATA TGTGGATTTG TTTTGTGGGT TTGATGGTAA TGTTATCCAT GATGCTACTA TGGGACACAT ATGTTCACAG
TAAATTGGGT TCAGTGACCT AATAAAAGAA ACAAATATTA TTAAGATTAG GCAATGCCAT GATTTAGAAA TAAACATGGC
CTTGTGCCAT CTCCCAAAAC TACCTAAAAA TAGAACAAAA TGTGTTTGAT CTCCATGTAT AGGCAGTAAA ACCATAGTTT
TGCGGCCATA ACTATTTGGA AGCTTGTTTC ATGGCACACC ATGAGAAGGA TGCACACATG TATCTGCTTG TCCTATGTTT
TATGGGCTCA TGGCACTGAT TGTAAATGTG AATGTCTGGT CCACCATTAT CTTCATATGT GATTGTACTT AGCATGCCTA
TAGAAGCCTA TCTTGGCATC ACTTGGATGG AGTTTATTGA AAATACTCTC ATGTATTTTG ATGGTGTGTT TGGTTGAGGG
AGGAGGGTGG ATGGGATAGG AAAATGCATG ATGGATGAAA TGGTCTAGAA TGGACTGTGA TACAAGTTGT CCCTCCATCT
CAAAATATAG CTACCTTTAG CATTCAAGTT CTGTTAAAAC AAAAGTTCTC ATCAGGTGTT AGCGCTATCT TGTTCACTTT
TGTCAACTGA AGTCGCGccc aaaatgtagc tacttacacc taccagtcat ctcaaccaat cacaaccatc tcatttaatt
tctccaccta cttactcatc ccaaccaatc acaaccatcc ccatttaatt ccacctactt ccttaaccaa ggtagctagc
tattttggga cggagggagt aGATGTTTGG TTGGTTACAC AGTATGGTAC AAATTTTCTT TGCTTGGTTG TGTCGGATGG
TTCAGGATGG TACCATACGA TGTTTGGTTT GTAAGATGAC AAGTAGGATA CTGTTTGACA CGCATGACCC ACAGCATGGT
TCAACATTTT TTTTCTCACA TGGAATTGTA CAGAATCAAT ATAGAATATT CCTGGAATAT GTATCCCACC ATCCGGGAGG
ATATTATCCC ATCTGTGAAA TCAAACAGCA TGATCAACCT TGAAGTTGAA GATCAAACCA TCCACTCTCA TCCCCTCATG
CATGCGTGTC AGACCATGCC ATGTCATAGC CTTGCCATGC CAACGTCCCT GGCGCGGCAA GGAAGCGCTG CAATGCCGTG
CTCCTTGGTG TGGCATAAAT GGCTGCTAGT GCTTGCATGC GTGTCAGACC ATGTCGTAGG TAGCTGCATG CTTTGCCTGT
GTTAGCTAGT AGGTGCATAC CATTGATCAC CACTCTTTGC ATATTTTCTA GATATTCATG TACAGTAATA TATGAAGATA
ATTGTCATAA AAGTTACTCC ATCCCATAAA AATTAAATCT AGTACGGGAT GTTTTTTATG GGACGGAGAG AGTACATCAT
ATATATCACT TTTACACAAA TGCATGTATG GCTAAATTAC ATCTATAATT TCAAACAAAA TAAACAAATA GTTATGAGTA
ACCACTGATA TAGCAGAGCA TGTAGGGACC GGACTCATAC TGCATGcttt gtttttccta tggcactttc aaaggactct
tattattttt tcctgtgttt ttttattgat gtaggattta agaaacatac tattttaatt tttgtgtttt ttctattcat
gtatttttcc tatcctacaa atcaaagggc ccTTCACTGA GTGGCTTGCG ACTTTGAAAT AATTCAGAGT GCAATATGTT
GTGACCCCCT CCTGTAATAT AATGACATCA CTTCAAAAAT ACTTTTAAAC GATCAATCAA CATTATTTGT TAGCTAGCTG
GCAACTCAAG CTAATTAATT AAAGTGTCAT ACATGTATGG CACGCTAGGG GGCCATTACC TCCAATAGGC ATGCAAAGCC
TGCTCGCATC CAAACCAGGG CATGATCAGC ATGCATGCAA ATCTCCGTCA TGCCGCAGGG CACGGCAATT CAGAGCAAGG
TTGTCACGCC AAGGATGTTG GCATGGCAAG GCTATGACGT AGCACAGTCT TTCAGTGTGT CACGTTCCAT CATGCCAGGG
TTATTTGGCA ACGCCAGTAT TCTTGGCATG GCCAAAAGAT TCAGATTTGG AAATAAAATT TTAATAGGGT CTAATATTAA
ATTATTATAT GTAAAAGGTT TAAGAAATAA AAACAATTCT GCGTGTTGAT CATTGTTGTT AAGTTGTAAA CTACTAAAGT
CAAGTTGATG CATCCTTCTA CCAACCTGTG GACCAGTCAT TACTAGTCGA TGAGTTGATT AGTGTTTTAT AAAGGAGATC
AGGGAAAAGA GGGAACACAT GAGCAAAGGA GGTGTGAAAT TCTTGCTGCT TCCTCTAATC TGGCTCTAGC TCTGGTGGCT
GGCTATATAT GGAAGAGGAA AATAACTCTC CTCTTTTTCC CCTTTCCTAT GAACTTGGCC TCCCAAACAA GACCCAGTTT
GCTCTCAAGC AGTCCCAAGT TGAGTCGTGT CCCTCTAGTT GTGCTCTATG GTCGACTTGT CAACTAGTCA CCTACTGTGT
AATAGTGGTT TGGATTTGCT GTTGGGACGG TAGACGACAC TCTCTCTTTG TCTAAATAGT AGTGATTTGT TATGACATGA
CTTTTTCTGC GTGCGTTTTA AATTACTGCC ATGCTGTACC ATATTGTTTT GCAGATCAGC ATCCTATTTG TTTTTACCAA
AGCATTTTGG TCTACAGCAT ATCTGAGGTG GTTATTGTAT TTTACATGTT CAAATTCAAT CAGCTGTTTC TACTTTGCTA
GTATTTTTTT TTATGTTAGC TTTACATTTT TCCAACAACA TCATTATGCA TTTTTGTCAA ACTAGTGCAT TGCTTTCATT
TCCTGTAAAT AATAGTTACA CTCCTTTTTT TTAACTCATC ATTGCCCGTA ATAATTCCTT TCCTTTTTCA AATATGAATG
AACCTGTTAT TTCTTATTTC AGGCGAATAA CAGAAGCTTG CATATGGGAT GATGTTTCAA GCCTTCCCAT GAGGAAGGCA
AAGTCACAGC TCATTGTCAT CCACTAGGCA TCAACCGTCC GTTGTATATT TTTGCATGGT AGCTGCAGTG CCCCGTGGCT
GATTCCCTCT CACCCTTGAA GCTTGATGCT TGCTTTTGTA GGAAGCTTGT TTTGCGCAGC AAGCACCGAG TTTCATACTT
GACCTCTGTT TTTCTTTTTT TTTCCCTTCA ATTGCTACGA GAACTCCATA TGTACATATA TCTGTACATT ACATGACTTC
AAAATGTGTC CCACTTCTGT CTGT