Os07t0446800-00

Locus

Os07g0446800

Description

Similar to Hexokinase.

Transcript Evidence

DQ116383 (DDBJ, Best hit)

Protein Evidence

Q8LH82 (UniProt)

CGSNL Gene Symbol

HXK1

CGSNL Gene Name

HEXOKINASE-1

CGSNL Gene Symbol Synonym(s)

OsHXK1

CGSNL Gene Name Synonym(s)

Hexokinase 1

Literature (PMID)

Manual Curation

Note

GO

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: phosphotransferase activity, alcohol group as acceptor (GO:0016773)

InterPro

Hexokinase (IPR001312)

Hexokinase, N-terminal (IPR022672)

Hexokinase, C-terminal (IPR022673)

KEGG

Os07t0446800-00 (EC:2.7.1.1)

Oryzabase

6750

Plant Gene Family Database (PGFD)

Os07t0446800-00

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os07t0446800-00

Transcript

1626 bp

>Os07t0446800-00 Similar to Hexokinase.
GGTTCAAAGCTTGTTCGATTCGTTCGCGCGGGACCATGGCGGCGGCGGCGGTGGCGGCAG
ATCAGAAGGTGGTGACGATGACGAGCCTCCGGGAGGGCTGCGCTTGCGCGGCGCCTCCTG
CTGCAGCTGCGCCGCCGATGCCGAAGATGGCGGCGGCGCAGAGGGTGGTGGCGGAGCTGA
GAGAAGCGTGCGCGACGCCGGCGGCGAGGCTGGCGGAGGTGGCCGCGGCGATGGCCGGCG
AGATGGAGGCCGGGCTGGCGGTGGAGGGCGGCAGCAGCGAGATGAAGATGATCGTGTCGT
ACGTCGACAGCCTCCCCACCGGCGGCGAGGAGGGGTCGTACTACGCGCTCGACCTCGGCG
GCACCAACTTCCGCGTCCTCCGCGTGCGGCTTGCCGGCGGCGGCGTCGCCGAGCGCGTGG
CGAGGGAGGTCCCGATCCCTCCCGGCCTCATGTCCGGCGGCGGCGCCACCTCGGAGTGCC
TCTTCGGCTTCATCGCCTCCGCGCTAGCCGAGTTCGTCGGCGAGGAGGAAGAAGAAGGCG
GCCTCGACGGCGGCGAGAGGGAGCTTGGGTTCACCTTCTCCTTCCCCGTGCACCAAACCT
CCATCGCGTCGGGGACGCTCATCCGGTGGACGAAGGCGTTCGCCGTCGACGACGCGATCG
GCGAGGACGTCGTGGCGGCGCTGCAGGCGGCCATGTCGGAGCGGGGGCTCGACATGCGCG
TGTCGGCGCTCATCAACGACACCGTCGGGACGCTCGCCGCGGGCAGCTACTACGACGAGG
ACGTCGTGGCCGCCGTCATCCTCGGCACCGGCACGAACGCCGCCTACGTCGAGGACGCCA
CCGCCATCGCCAAGCTACACCCATCGCAGCTGCCAGCATCGAACACCATGGTGATCAACA
CCGAGTGGGGCAGCTTCGCCTCGCCGTGCCTCCCATTGACGGAGTTCGACGAAGCACTCG
ATCAGGAGAGCCTCAACCCCGGCGAGCAGACCTACGAGAAGCTCATCTCCGGGATGTACC
TCGGCGAGATCGTCAGGAGGGTCCTCCTCAAGATCTCCTCCCGGTGCCCCTCCCTCCTCG
GCGGCGCCGGCGAGCTCGCGACGCCGTTCGTCCTCAGGACACCCGACGTGTCCGCGATGC
ACCACGACGAGACGCCCGACCTGAGCATCGTCGGCGAGAAGCTGGAACGCACGCTGGGCA
TCCGCGGCACGTCGCCGGAGGCGAGGAGGATGGTCGTCGAGGTGTGCGACATCGTCGCCA
CGAGGGCCGCCCGGCTGGCCGCGGCGGGGATCGTCGGGATCCTGAAGAAGATCGGGAGGG
TCGACGGCGGCGAGGGGCGGAGGAGGAGGTCGGTGGTCGCCGTGGACGGCGGGCTGTTCG
AGCACTACGGCAAGTTCCGGCGGTGCATGGAGAGCGCGGTGAGGGAGCTGCTCGGAGAGG
CGGCGGCGGAGAGGGTGGTCGTCAAGCTCGCCAGCGACGGCTCCGGGCTCGGCGCCGCCC
TGGTTGCAGCTGCTCACTCGCAGAGAGCATAATATTGAATTGTGGTGAAATATGCGTGTG
TTTGAAACAAGCTTGAATGATTTGAATATTTGATGCGATTTGCAAAACCACATATGAAAT
AGAAGC

CDS

1497 bp

>Os07t0446800-00 Similar to Hexokinase.
ATGGCGGCGGCGGCGGTGGCGGCAGATCAGAAGGTGGTGACGATGACGAGCCTCCGGGAG
GGCTGCGCTTGCGCGGCGCCTCCTGCTGCAGCTGCGCCGCCGATGCCGAAGATGGCGGCG
GCGCAGAGGGTGGTGGCGGAGCTGAGAGAAGCGTGCGCGACGCCGGCGGCGAGGCTGGCG
GAGGTGGCCGCGGCGATGGCCGGCGAGATGGAGGCCGGGCTGGCGGTGGAGGGCGGCAGC
AGCGAGATGAAGATGATCGTGTCGTACGTCGACAGCCTCCCCACCGGCGGCGAGGAGGGG
TCGTACTACGCGCTCGACCTCGGCGGCACCAACTTCCGCGTCCTCCGCGTGCGGCTTGCC
GGCGGCGGCGTCGCCGAGCGCGTGGCGAGGGAGGTCCCGATCCCTCCCGGCCTCATGTCC
GGCGGCGGCGCCACCTCGGAGTGCCTCTTCGGCTTCATCGCCTCCGCGCTAGCCGAGTTC
GTCGGCGAGGAGGAAGAAGAAGGCGGCCTCGACGGCGGCGAGAGGGAGCTTGGGTTCACC
TTCTCCTTCCCCGTGCACCAAACCTCCATCGCGTCGGGGACGCTCATCCGGTGGACGAAG
GCGTTCGCCGTCGACGACGCGATCGGCGAGGACGTCGTGGCGGCGCTGCAGGCGGCCATG
TCGGAGCGGGGGCTCGACATGCGCGTGTCGGCGCTCATCAACGACACCGTCGGGACGCTC
GCCGCGGGCAGCTACTACGACGAGGACGTCGTGGCCGCCGTCATCCTCGGCACCGGCACG
AACGCCGCCTACGTCGAGGACGCCACCGCCATCGCCAAGCTACACCCATCGCAGCTGCCA
GCATCGAACACCATGGTGATCAACACCGAGTGGGGCAGCTTCGCCTCGCCGTGCCTCCCA
TTGACGGAGTTCGACGAAGCACTCGATCAGGAGAGCCTCAACCCCGGCGAGCAGACCTAC
GAGAAGCTCATCTCCGGGATGTACCTCGGCGAGATCGTCAGGAGGGTCCTCCTCAAGATC
TCCTCCCGGTGCCCCTCCCTCCTCGGCGGCGCCGGCGAGCTCGCGACGCCGTTCGTCCTC
AGGACACCCGACGTGTCCGCGATGCACCACGACGAGACGCCCGACCTGAGCATCGTCGGC
GAGAAGCTGGAACGCACGCTGGGCATCCGCGGCACGTCGCCGGAGGCGAGGAGGATGGTC
GTCGAGGTGTGCGACATCGTCGCCACGAGGGCCGCCCGGCTGGCCGCGGCGGGGATCGTC
GGGATCCTGAAGAAGATCGGGAGGGTCGACGGCGGCGAGGGGCGGAGGAGGAGGTCGGTG
GTCGCCGTGGACGGCGGGCTGTTCGAGCACTACGGCAAGTTCCGGCGGTGCATGGAGAGC
GCGGTGAGGGAGCTGCTCGGAGAGGCGGCGGCGGAGAGGGTGGTCGTCAAGCTCGCCAGC
GACGGCTCCGGGCTCGGCGCCGCCCTGGTTGCAGCTGCTCACTCGCAGAGAGCATAA

Protein

499 aa

>Os07t0446800-00 Similar to Hexokinase.
MAAAAVAADQKVVTMTSLREGCACAAPPAAAAPPMPKMAAAQRVVAELREACATPAARLA
EVAAAMAGEMEAGLAVEGGSSEMKMIVSYVDSLPTGGEEGSYYALDLGGTNFRVLRVRLA
GGGVAERVAREVPIPPGLMSGGGATSECLFGFIASALAEFVGEEEEEGGLDGGERELGFT
FSFPVHQTSIASGTLIRWTKAFAVDDAIGEDVVAALQAAMSERGLDMRVSALINDTVGTL
AAGSYYDEDVVAAVILGTGTNAAYVEDATAIAKLHPSQLPASNTMVINTEWGSFASPCLP
LTEFDEALDQESLNPGEQTYEKLISGMYLGEIVRRVLLKISSRCPSLLGGAGELATPFVL
RTPDVSAMHHDETPDLSIVGEKLERTLGIRGTSPEARRMVVEVCDIVATRAARLAAAGIV
GILKKIGRVDGGEGRRRRSVVAVDGGLFEHYGKFRRCMESAVRELLGEAAAERVVVKLAS
DGSGLGAALVAAAHSQRA*

5'UTR

chr07:15293180..15293214 (+ strand) : 35 bp

CDS

chr07:15293215..15294711 (+ strand) : 1497 bp

3'UTR

chr07:15294712..15294805 (+ strand) : 94 bp

FASTA

>Os07t0446800-00 class=Sequence position=chr07:15293180..15294805 (+ strand)
GGTTCAAAGC TTGTTCGATT CGTTCGCGCG GGACCATGGC GGCGGCGGCG GTGGCGGCAG ATCAGAAGGT GGTGACGATG
ACGAGCCTCC GGGAGGGCTG CGCTTGCGCG GCGCCTCCTG CTGCAGCTGC GCCGCCGATG CCGAAGATGG CGGCGGCGCA
GAGGGTGGTG GCGGAGCTGA GAGAAGCGTG CGCGACGCCG GCGGCGAGGC TGGCGGAGGT GGCCGCGGCG ATGGCCGGCG
AGATGGAGGC CGGGCTGGCG GTGGAGGGCG GCAGCAGCGA GATGAAGATG ATCGTGTCGT ACGTCGACAG CCTCCCCACC
GGCGGCGAGG AGGGGTCGTA CTACGCGCTC GACCTCGGCG GCACCAACTT CCGCGTCCTC CGCGTGCGGC TTGCCGGCGG
CGGCGTCGCC GAGCGCGTGG CGAGGGAGGT CCCGATCCCT CCCGGCCTCA TGTCCGGCGG CGGCGCCACC TCGGAGTGCC
TCTTCGGCTT CATCGCCTCC GCGCTAGCCG AGTTCGTCGG CGAGGAGGAA GAAGAAGGCG GCCTCGACGG CGGCGAGAGG
GAGCTTGGGT TCACCTTCTC CTTCCCCGTG CACCAAACCT CCATCGCGTC GGGGACGCTC ATCCGGTGGA CGAAGGCGTT
CGCCGTCGAC GACGCGATCG GCGAGGACGT CGTGGCGGCG CTGCAGGCGG CCATGTCGGA GCGGGGGCTC GACATGCGCG
TGTCGGCGCT CATCAACGAC ACCGTCGGGA CGCTCGCCGC GGGCAGCTAC TACGACGAGG ACGTCGTGGC CGCCGTCATC
CTCGGCACCG GCACGAACGC CGCCTACGTC GAGGACGCCA CCGCCATCGC CAAGCTACAC CCATCGCAGC TGCCAGCATC
GAACACCATG GTGATCAACA CCGAGTGGGG CAGCTTCGCC TCGCCGTGCC TCCCATTGAC GGAGTTCGAC GAAGCACTCG
ATCAGGAGAG CCTCAACCCC GGCGAGCAGA CCTACGAGAA GCTCATCTCC GGGATGTACC TCGGCGAGAT CGTCAGGAGG
GTCCTCCTCA AGATCTCCTC CCGGTGCCCC TCCCTCCTCG GCGGCGCCGG CGAGCTCGCG ACGCCGTTCG TCCTCAGGAC
ACCCGACGTG TCCGCGATGC ACCACGACGA GACGCCCGAC CTGAGCATCG TCGGCGAGAA GCTGGAACGC ACGCTGGGCA
TCCGCGGCAC GTCGCCGGAG GCGAGGAGGA TGGTCGTCGA GGTGTGCGAC ATCGTCGCCA CGAGGGCCGC CCGGCTGGCC
GCGGCGGGGA TCGTCGGGAT CCTGAAGAAG ATCGGGAGGG TCGACGGCGG CGAGGGGCGG AGGAGGAGGT CGGTGGTCGC
CGTGGACGGC GGGCTGTTCG AGCACTACGG CAAGTTCCGG CGGTGCATGG AGAGCGCGGT GAGGGAGCTG CTCGGAGAGG
CGGCGGCGGA GAGGGTGGTC GTCAAGCTCG CCAGCGACGG CTCCGGGCTC GGCGCCGCCC TGGTTGCAGC TGCTCACTCG
CAGAGAGCAT AATATTGAAT TGTGGTGAAA TATGCGTGTG TTTGAAACAA GCTTGAATGA TTTGAATATT TGATGCGATT
TGCAAAACCA CATATGAAAT AGAAGC