Os07t0602200-01

Locus

Os07g0602200

Description

Similar to HDA1.

Transcript Evidence

AK111892 (DDBJ, Best hit)

Protein Evidence

B6SH90 (UniProt)

CGSNL Gene Symbol

CGSNL Gene Name

CGSNL Gene Symbol Synonym(s)

CGSNL Gene Name Synonym(s)

Literature (PMID)

Manual Curation

Note

InterPro

Histone deacetylase superfamily (IPR000286)

Histone deacetylase domain (IPR023801)

KEGG

Os07t0602200-01 (EC:3.5.1.98)

KOME

J033079C01 (Online Clone Ordering)

RiceXPro Database

AK111892

Plant Gene Family Database (PGFD)

Os07t0602200-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os07t0602200-01

Transcript

2597 bp

>Os07t0602200-01 Similar to HDA1.
TCCATTTCCGAATCGTCGTCTCGCCTCCACTTCCGACTTCCGAGTCGTCTCGCCTCGCCG
GCGCAGGATGGCGGCGGCGACGACCGCCGCGGCGGCGGCGAGGGTGGGGCTGCTGTACGA
CGAGAGGATGTGCGCGCACGCGACGCCCGACGGGGAGGAGCACCCGGAGAACCCCGAGAG
GCTGCGGGCCATCTGGCGCAAGCTCTCCGCCGACGGCGTCGCCTCCAGGTGCATGATCAT
GAAAGCGAAGGAAGCTGAGGACAAGTATATAGCTTCTGTCCATAGCCAGAACCATATCAA
GCTGATGAGGAGTATCAGCTCAAAAGAATATGATTCCCGTCGAAACAAGATTGCTAGAAA
ATTTAATTCCATTTACTTCAACAAGGGCTCCTCAGAGTCTGCTTTTCTTGCAGCTGGTTC
TGTGATTGAGGTAGCTGAGAAGGTTGCTGCAGGAGAGTTAAGTTCTGCTATTGCTCTAGT
CCGACCTCCAGGTCACCATGCTGAACATAATGAGGCAATGGGTTTTTGCCTCTTCAACAA
TGTAGCAATTGCTGCTGATTATCTCTTAAATGAGAGGACTGACTTAGGTATCAAGAAGAT
ATTGATTGTCGATTGGGATGTTCATCATGGAAATGGCACACAAAAGATGTTTTATAGTGA
TCCTCGTGTATTGTTCTTTTCAGTTCACAGATTTGATTATGGCAGCTTCTATCCTGCTGA
AGGGGATGCATCTTACTGTTTCATTGGGGAAGGAGATGGTAAAGGGTACAACATTAACGT
GCCCTGGGAACATGGAAAATGTGGTGATGCAGATTATATTGCTGCATGGGACCATGTACT
ACTTCCTGTTGCTGAAGCATTTAACCCTGATATAGTCTTGGTGTCTGCTGGGTTTGATGC
AGCACTGGGTGATCCTCTTGGTGGCTGCTGCATCACTCCCAATGGATATGCTCTGCTACT
GACAAAGCTCTTAGGTTTTGCCCAAGGGAGGATAGTGATGGCTCTTGAAGGAGGCTATAA
CCTTAGATCCATAGCAAATTCAGTTAGTGCTTGTGCTAAAGTTTTGTTGGGAGACAAGTT
CAGATTTGACACTCCTGATATGCAACCGTTTGAATCTTCATGGAGAGTTATACAAGCGGT
ACGTGATGAATTGAAGACGTTCTGGCCTGTTCTGAGTAATAGATTGCCAGAGAATATATC
ATTGAGGAGTAGGCCCTCACAAATTGAGCTGTATTCTTCTGGTTCTGACTCTGAAGTTGA
AGATCTCCCTGATGCTATTGCTTCTGTCAATATTATTCAAATTACTTATGGTATTATAAG
TGAAAGCCTCTCAAAGTTGAACCTTGATGAAGACAAAATCGCAACAAAGACCACCTCAAG
TAATGTAATGGTTGAAGGTCCAACTGATTCAGTTGAACCACAAAATGATGGATCTGCTGC
GGTGTCAACTGAAGGAATATCATCTCTATCTTCTACTTGGAGATCAGAACTGTCAAAAGT
ATATGTTTGGTATGCCAGCTTTGGTTCAAACATGTGGACACCAAGGTTTCTGTGCTACAT
CCAAGGGGGAAAGGCTGAGGGTATGAATATACCATGTTTTGGATCTCATGACACAAGCCC
ACCAAGAGGTTCCATGTGGAAGACTGTGCCTCATAGATTGTTTTTTGGTAGATCCTCTAC
TCCTTGCTGGGGAACTGGTGGTGTTGCTTTTCTCAACCCTGAGATAAACCACACTGAGAA
CTCCTATGTCTGCATGTATAAAATAACGCTCGAGCAGTTCAATGATGTATTGTTTCAAGA
GAATCGTTTAGTGAAGGAGAACGGCGAAAGTGGAAAAACTGAGTCTCCTGACTCTCCTTT
GATTGGCTTGTCTGAAATAGAGTTTGTTTCCAGAAACAAGGGTGTCCACCTTGCACCTAT
TAAGGATAGCTGGTACTCCAATGTACTTTACCTTGGGGAGGAGGATAACCTTCCAATTCT
TACAATGACATGCCCGTCATCAGACGTAGAGCGATGCAGATCCGGAGAGCTGCCATTGTG
TCCTCCATCCAAGACCTACTCCGCCACCCTGATAAGGGGACTAATGGAAGGGAAGCACCT
GGATGCAGATGCGGCCGCTAGTTACATCAACACTGCAGCTACCAGAGGCCTGTGAAGGCT
GCTTCCCTATGCATTATGGTTTGTAGTTTTGCACTAAGCATGTAAGTGGCTAACCCACGA
ATCCACTTATTTTCACTTATAAGTGGGTTTGCAGATTAGCCACTTACGCGCTTAGTTTGT
ACAGCCAGTAGGAGCGTACTAGGACTGTAGGAGGAATGATGAGTAGGTTTGCAGGACTGT
AAAGATAGTGCGTTGATCATTCAGGACCACGGGGGCTTATGTAGAGGCCTCGTGAATGTC
CTGCCAATTGGGGAATCTGGACCCGATCAAGTTTCCCTAGGATTGTTAAGAATCTAGCTA
GCGCTTGTACCCTGGGTTGGTCATTGTCTCATTGGTGCTCTCCGGATTGGTTTGTTTTGG
GGTGGAAAAAAAAACACTAGTCGATGTTGCCTGGTTTTTCATGCTGTTACCTGGCGAGGA
AATGACGATTTCTTGTG

CDS

2088 bp

>Os07t0602200-01 Similar to HDA1.
ATGGCGGCGGCGACGACCGCCGCGGCGGCGGCGAGGGTGGGGCTGCTGTACGACGAGAGG
ATGTGCGCGCACGCGACGCCCGACGGGGAGGAGCACCCGGAGAACCCCGAGAGGCTGCGG
GCCATCTGGCGCAAGCTCTCCGCCGACGGCGTCGCCTCCAGGTGCATGATCATGAAAGCG
AAGGAAGCTGAGGACAAGTATATAGCTTCTGTCCATAGCCAGAACCATATCAAGCTGATG
AGGAGTATCAGCTCAAAAGAATATGATTCCCGTCGAAACAAGATTGCTAGAAAATTTAAT
TCCATTTACTTCAACAAGGGCTCCTCAGAGTCTGCTTTTCTTGCAGCTGGTTCTGTGATT
GAGGTAGCTGAGAAGGTTGCTGCAGGAGAGTTAAGTTCTGCTATTGCTCTAGTCCGACCT
CCAGGTCACCATGCTGAACATAATGAGGCAATGGGTTTTTGCCTCTTCAACAATGTAGCA
ATTGCTGCTGATTATCTCTTAAATGAGAGGACTGACTTAGGTATCAAGAAGATATTGATT
GTCGATTGGGATGTTCATCATGGAAATGGCACACAAAAGATGTTTTATAGTGATCCTCGT
GTATTGTTCTTTTCAGTTCACAGATTTGATTATGGCAGCTTCTATCCTGCTGAAGGGGAT
GCATCTTACTGTTTCATTGGGGAAGGAGATGGTAAAGGGTACAACATTAACGTGCCCTGG
GAACATGGAAAATGTGGTGATGCAGATTATATTGCTGCATGGGACCATGTACTACTTCCT
GTTGCTGAAGCATTTAACCCTGATATAGTCTTGGTGTCTGCTGGGTTTGATGCAGCACTG
GGTGATCCTCTTGGTGGCTGCTGCATCACTCCCAATGGATATGCTCTGCTACTGACAAAG
CTCTTAGGTTTTGCCCAAGGGAGGATAGTGATGGCTCTTGAAGGAGGCTATAACCTTAGA
TCCATAGCAAATTCAGTTAGTGCTTGTGCTAAAGTTTTGTTGGGAGACAAGTTCAGATTT
GACACTCCTGATATGCAACCGTTTGAATCTTCATGGAGAGTTATACAAGCGGTACGTGAT
GAATTGAAGACGTTCTGGCCTGTTCTGAGTAATAGATTGCCAGAGAATATATCATTGAGG
AGTAGGCCCTCACAAATTGAGCTGTATTCTTCTGGTTCTGACTCTGAAGTTGAAGATCTC
CCTGATGCTATTGCTTCTGTCAATATTATTCAAATTACTTATGGTATTATAAGTGAAAGC
CTCTCAAAGTTGAACCTTGATGAAGACAAAATCGCAACAAAGACCACCTCAAGTAATGTA
ATGGTTGAAGGTCCAACTGATTCAGTTGAACCACAAAATGATGGATCTGCTGCGGTGTCA
ACTGAAGGAATATCATCTCTATCTTCTACTTGGAGATCAGAACTGTCAAAAGTATATGTT
TGGTATGCCAGCTTTGGTTCAAACATGTGGACACCAAGGTTTCTGTGCTACATCCAAGGG
GGAAAGGCTGAGGGTATGAATATACCATGTTTTGGATCTCATGACACAAGCCCACCAAGA
GGTTCCATGTGGAAGACTGTGCCTCATAGATTGTTTTTTGGTAGATCCTCTACTCCTTGC
TGGGGAACTGGTGGTGTTGCTTTTCTCAACCCTGAGATAAACCACACTGAGAACTCCTAT
GTCTGCATGTATAAAATAACGCTCGAGCAGTTCAATGATGTATTGTTTCAAGAGAATCGT
TTAGTGAAGGAGAACGGCGAAAGTGGAAAAACTGAGTCTCCTGACTCTCCTTTGATTGGC
TTGTCTGAAATAGAGTTTGTTTCCAGAAACAAGGGTGTCCACCTTGCACCTATTAAGGAT
AGCTGGTACTCCAATGTACTTTACCTTGGGGAGGAGGATAACCTTCCAATTCTTACAATG
ACATGCCCGTCATCAGACGTAGAGCGATGCAGATCCGGAGAGCTGCCATTGTGTCCTCCA
TCCAAGACCTACTCCGCCACCCTGATAAGGGGACTAATGGAAGGGAAGCACCTGGATGCA
GATGCGGCCGCTAGTTACATCAACACTGCAGCTACCAGAGGCCTGTGA

Protein

696 aa

>Os07t0602200-01 Similar to HDA1.
MAAATTAAAAARVGLLYDERMCAHATPDGEEHPENPERLRAIWRKLSADGVASRCMIMKA
KEAEDKYIASVHSQNHIKLMRSISSKEYDSRRNKIARKFNSIYFNKGSSESAFLAAGSVI
EVAEKVAAGELSSAIALVRPPGHHAEHNEAMGFCLFNNVAIAADYLLNERTDLGIKKILI
VDWDVHHGNGTQKMFYSDPRVLFFSVHRFDYGSFYPAEGDASYCFIGEGDGKGYNINVPW
EHGKCGDADYIAAWDHVLLPVAEAFNPDIVLVSAGFDAALGDPLGGCCITPNGYALLLTK
LLGFAQGRIVMALEGGYNLRSIANSVSACAKVLLGDKFRFDTPDMQPFESSWRVIQAVRD
ELKTFWPVLSNRLPENISLRSRPSQIELYSSGSDSEVEDLPDAIASVNIIQITYGIISES
LSKLNLDEDKIATKTTSSNVMVEGPTDSVEPQNDGSAAVSTEGISSLSSTWRSELSKVYV
WYASFGSNMWTPRFLCYIQGGKAEGMNIPCFGSHDTSPPRGSMWKTVPHRLFFGRSSTPC
WGTGGVAFLNPEINHTENSYVCMYKITLEQFNDVLFQENRLVKENGESGKTESPDSPLIG
LSEIEFVSRNKGVHLAPIKDSWYSNVLYLGEEDNLPILTMTCPSSDVERCRSGELPLCPP
SKTYSATLIRGLMEGKHLDADAAASYINTAATRGL*

5'UTR

chr07:24592035..24592101 (+ strand) : 67 bp

CDS

chr07:24592102..24592262 (+ strand) : 161 bp

chr07:24592809..24593010 (+ strand) : 202 bp

chr07:24593109..24593255 (+ strand) : 147 bp

chr07:24593412..24593524 (+ strand) : 113 bp

chr07:24594160..24594371 (+ strand) : 212 bp

chr07:24594774..24594838 (+ strand) : 65 bp

chr07:24595161..24595331 (+ strand) : 171 bp

chr07:24595418..24595507 (+ strand) : 90 bp

chr07:24596123..24596467 (+ strand) : 345 bp

chr07:24596560..24596753 (+ strand) : 194 bp

chr07:24596872..24597028 (+ strand) : 157 bp

chr07:24597526..24597590 (+ strand) : 65 bp

chr07:24597746..24597911 (+ strand) : 166 bp

3'UTR

chr07:24597912..24598353 (+ strand) : 442 bp

FASTA

>Os07t0602200-01 class=Sequence position=chr07:24592035..24598353 (+ strand)
TCCATTTCCG AATCGTCGTC TCGCCTCCAC TTCCGACTTC CGAGTCGTCT CGCCTCGCCG GCGCAGGATG GCGGCGGCGA
CGACCGCCGC GGCGGCGGCG AGGGTGGGGC TGCTGTACGA CGAGAGGATG TGCGCGCACG CGACGCCCGA CGGGGAGGAG
CACCCGGAGA ACCCCGAGAG GCTGCGGGCC ATCTGGCGCA AGCTCTCCGC CGACGGCGTC GCCTCCAGGT ATACGTATAC
CCCCACCCCC CGCCGCTCGC GGCGTTTTTC TTTTTTGTCC TTAAGGACTT GGGAGAGTCG GATCGGAGTA GCGTGATTTT
GCTGGGATCG GCGACGCGCG CGGCGGCTTC GATGCTCTCA TGGTTCGGCC GAATTGTTGT GGTAGGGGAG CCGCGGCATG
CCTGTAGCCA TTTCCGTTCA GTTCTAGCAC GGAACCTAGG GTTCGCGCAA ATTTTGTCTC GAGACGGTAT GTGTTGGTGA
ATGGTGACTC TAATTGTGTA CTTAGGTAAA AACATCCCAA ATGCTAGAAG TACCCGAGAA AATCAGGGGG GGAGATGTAT
TGGTACAGGC TGTGGCTTGA ACTACAGTAC TGAAGCAATC GTAGCAAACT TGTGTGATTT ACGCTGCACA GCAACTTTGA
TGATACTTCT TGGTTAAGCT TAAACATTAG CATAACAACT TAGGTCACTT AACTTTGCTC ATTGCTTTGA CTGGCTTATA
ATTTTGCTGC TGGCAAAGCT TCCTTGGATG TAATGTAGCA TAGTTTTCTC CCAGGTGCAT GATCATGAAA GCGAAGGAAG
CTGAGGACAA GTATATAGCT TCTGTCCATA GCCAGAACCA TATCAAGCTG ATGAGGAGTA TCAGCTCAAA AGAATATGAT
TCCCGTCGAA ACAAGATTGC TAGAAAATTT AATTCCATTT ACTTCAACAA GGGCTCCTCA GAGTCTGCTT TTCTTGCAGC
TGGTTCTGTG ATTGAGGTGA TTCAACATTT GACATGAACA TTTATTGTGT AGTTGATTGC TCTTTCCTTG TGCTGATTGC
TCTGCAAAAA ATAATCAACT CATTTGGCAA ATAGGTAGCT GAGAAGGTTG CTGCAGGAGA GTTAAGTTCT GCTATTGCTC
TAGTCCGACC TCCAGGTCAC CATGCTGAAC ATAATGAGGC AATGGGTTTT TGCCTCTTCA ACAATGTAGC AATTGCTGCT
GATTATCTCT TAAATGAGAG GGTATGTTGT TGAAACTTGC CTATTTTTTT AGTACCAAAA TCTGCTCTCC TTTTTTTTTT
CCCTTCGTCA TTTCCTATAT AGGAACAGGA ATGTTTTTAT CAGATGCAGT TGAATGAGAA GGTGAACTCA TGTTCCTATT
TGCCTTTTTT GTTGCAGACT GACTTAGGTA TCAAGAAGAT ATTGATTGTC GATTGGGATG TTCATCATGG AAATGGCACA
CAAAAGATGT TTTATAGTGA TCCTCGTGTA TTGTTCTTTT CAGTTCACAG GTATGACAGC CTCTTGACAT GGACTTTATA
GTTTTTTTTG GGTCTTTTTA GTAGCATCAT TACTTTCATG ACATGATACT ATGATAGTAC TAAGTAAAGT CATGGCAGTT
TTGTTGCCTT CATTCTGGAG GTTTACCGCA CTTTGAATGG TTGTACTACT TTGCCAAACA TATCTTTTCC CCTATGGAAG
CATTGAATGC TTCTAATTAA TATAGAAATT TAAGGGCACT CTCTGTTATT TCCATGGTCC TAACAAACCC GTTTATAATG
GACAGATAGT AAATGTATTA TTTTTCCTTT AATGAATAGG ATTGAATCCC GCATTCCACC AATCCACACT GATTATCGTA
CATTATTGCT CTTCGAATGA AAAGAAAATG GCATCACCCA AATAATATCT GTTGCTGGAT GACATGGTGC ACATTGAATA
ATTTAGGCAG CATTACAGAA ATGTAAATGC TTAAGTCGAG TTTTCCCCAA GGAATCTTTT AGAGCAGTTG TAAACATTAA
TTGTTTTGCT TTGGTCCTAT GGCAAAGCTA GAGATGTACT GGTTCAGAAG CATAATCAAT TGTATGTCTG ATGAGAACCT
ATTCATTTTA GTGTATGATG CTTGTGTCCT ATGTTTCTTT TGTAGATTTG ATTATGGCAG CTTCTATCCT GCTGAAGGGG
ATGCATCTTA CTGTTTCATT GGGGAAGGAG ATGGTAAAGG GTACAACATT AACGTGCCCT GGGAACATGG AAAATGTGGT
GATGCAGATT ATATTGCTGC ATGGGACCAT GTACTACTTC CTGTTGCTGA AGCATTTAAC CCTGATATAG TCTTGGTGTC
TGCTGGGTTT GATGCAGGTA TATAGTTTAA AAGTTCGTAG AACTCTTTTG TGCCAGCAAC ATACTAACTT TAAAAAGAAA
CTTATAAAAT AAAAATGCAG CCTTTTGTCT TGAATGAAAC TGTTTATATA GTGTTAATTT ATAGCTTCTC AATTTTATCT
CTATGAGCTA GTTGACCGCT GCTTGTGCTA GTAGCATAGT GCAGCTTGCA ACCTATTATA TCTGATTTCG TTGTGGAATG
ATAAATGAGA TCTTTGCTGC AGAAATATTG AAAAAAAAAT CTCTAAGAGT TTGTTTTATA AGACTGTTAC TACATGATAA
CAGAGCCTAA ACTTCTGGTA TATCTAATAC AGTACTAGAT CATATATGTG CCGTTGTTCG CTAGTTCTGA TTTTTTCTCT
ACACTGATAT TTTGGGTAGC ACTGGGTGAT CCTCTTGGTG GCTGCTGCAT CACTCCCAAT GGATATGCTC TGCTACTGAC
AAAGGTAAGC ACTTGCAGAA AAATAACATT CAGTTAGGCT TTCACCACGC CATGCATTTT CCTGTCTCTA AAGGAATAAC
ATTCAGATCA GCTGGGTTAG GTTAATAATA TCGAAGTTTT CCAACACAGC AACCAGAAAC TTTTTATGTA ACTTTTTCCT
TAGTAATTTC TTATTGGTAT TCTCTGCTGT TAGCTGTTAG GATATTTTCA TTTGATCTCT TCCAGTTACT TCATATCTCT
TTATGTCTAC TGGGCTGTGC TAAAATTATT ATTATTATTA TTTTTTAAAA AATAGTAATA TTTAATTCTG TATGTAAAAC
CTGCAGCTCT TAGGTTTTGC CCAAGGGAGG ATAGTGATGG CTCTTGAAGG AGGCTATAAC CTTAGATCCA TAGCAAATTC
AGTTAGTGCT TGTGCTAAAG TTTTGTTGGG AGACAAGTTC AGATTTGACA CTCCTGATAT GCAACCGTTT GAATCTTCAT
GGAGAGTTAT ACAAGCGGTA ATGGTCTGCT TACATTAATT GCTGTCTGAT TCCTTACTGT GGATATCTGT AATTATGTTT
CCTTCCCCCA CACCACTGAC CAGGTACGTG ATGAATTGAA GACGTTCTGG CCTGTTCTGA GTAATAGATT GCCAGAGAAT
ATATCATTGA GGAGTAGGCC CTCACAAATT GAGGTAGATA CTTATTTTTC TTATCTTAAA GACTTTTAAC TTGGGATATT
CTTGGTCTAA TCCCAGATTA ATTTGCTCTG ACATAAGATG CACCATCGCT TAACCCTGGA TTTACTTGTG TTTGCCAGGA
GTTTGGCACC CTTTTCTTAG CACTTAATTT ATATAGACAT GTAATAACAA TAGTTGCAGG TTGCACTGTG TATTCATGAT
GACTTCTGCT ACAAAAACAA TTGTACTGTA GCTTAACTCC AAAGAAAAAT ACATGCTGGG CTGTATCAAC TCTGTTATGC
ATTTCAATTG ATAGGCTACT TGCTTACAGC CTGTACTTTG ATGAACTGTT TAAAAATGCT TAAAAAATAC ATCATGCATA
GACCCATATC CTGGAGATGC TTCATGCCTC TCAACTCTTA CAAAGCACAG TTACACTGGT CGACTTTATC AACATCATGC
ATCTTAATTT GTATTGAGTT AATGATCTTG GTTTTGATTC ATTAACATAT TTGGCCTGCT GCATGGTGGC TTAATGTATA
GCTAAGACAA AATTGTAGGG AAATATCAAC ATTGTGTTGC CCTTGACTAA TTCACCTTTT TGTTTCCCCC CACTTTTGGT
ATGATCAGCT GTATTCTTCT GGTTCTGACT CTGAAGTTGA AGATCTCCCT GATGCTATTG CTTCTGTCAA TATTATTCAA
ATTACTTATG GTATTATAAG TGAAAGCCTC TCAAAGTTGA ACCTTGATGA AGACAAAATC GCAACAAAGA CCACCTCAAG
TAATGTAATG GTTGAAGGTC CAACTGATTC AGTTGAACCA CAAAATGATG GATCTGCTGC GGTGTCAACT GAAGGAATAT
CATCTCTATC TTCTACTTGG AGATCAGAAC TGTCAAAAGT ATATGTTTGG TATGCCAGCT TTGGTTCAAA CATGTGGACA
CCAAGGTTTC TGTGCTACAT CCAAGGGGGA AAGGTAAAGT GAAAACGTAT TCTCCTAGTT TTCCTATTTT TGATAAGCAG
CATGCTCTGC ATGATGGATT TGCTATTTAT TTTAATGTTG GACAGGCTGA GGGTATGAAT ATACCATGTT TTGGATCTCA
TGACACAAGC CCACCAAGAG GTTCCATGTG GAAGACTGTG CCTCATAGAT TGTTTTTTGG TAGATCCTCT ACTCCTTGCT
GGGGAACTGG TGGTGTTGCT TTTCTCAACC CTGAGATAAA CCACACTGAG AACTCCTATG TCTGCATGTA TAAAATAACG
TATGTATGTT GTAGCATCTG CCTACCTGTT ATCAATCTTT GAGTTAGGCA CTGTGGGGGT ATGATCTTCA GTTAATCTTC
TGGATCTCAT CATAATTTGC CTATCTTTTT TGTACAGGCT CGAGCAGTTC AATGATGTAT TGTTTCAAGA GAATCGTTTA
GTGAAGGAGA ACGGCGAAAG TGGAAAAACT GAGTCTCCTG ACTCTCCTTT GATTGGCTTG TCTGAAATAG AGTTTGTTTC
CAGAAACAAG GGTGTCCACC TTGCACCTAT TAAGGTTTGA TTTAACTGCA ACAAGCATGC TCTTGTTCTT GCAACTATTT
AACTTTGAAT GCATAGCCGC CATTACAAAC ATCATTGTTG GGTGCTTAGA CATAAGCAGC ATGCTGATAA AAGGCCTACC
AAATGCGCTC AGTTCACCAT GACCGCATCT GCCACTTGTG CCCAGATGAC ATTTTTATAG AAGTTAGTGG TGTGCCAACT
GTTAATGGTG AGTTGGTTAT AGCAAGGAAA TGCCAATTAC CTCTTAGTGC TGTCAGATTT TTCTGGGCTT TGAATTGTTT
GTATTTCCCG GGAGCTAGTC TAGACCAAGA AAATTCCGCA GAGTGTATTT TGGACATCGT AAGCAGTAGT GAAACAATCA
CTTGATAAGC AAGAATTTCT CACTATGGGC AGTCATGGGC ATGACTTGGA ACTACAGTAT TTCATTCCCT ATCATTTGCT
TTCTGCATTG AATGTTTTGC ATATCTGATA GTTGAATTCT ATTCCCTGCA GGATAGCTGG TACTCCAATG TACTTTACCT
TGGGGAGGAG GATAACCTTC CAATTCTTAC AATGACGTAA GTGTCTGTAC CTTTAAGTTC CTTTTTACGA TATAGATTAC
TTGCAACTCA ATGCACCATT TGAATGGCAG TTGAAATATA CCGGTAAGAT AAGTCTCACA ATCCAAGCAC TTCGCTTGTG
TCTAACACGA AGTGTTTCTT TCTCTCTGCA GATGCCCGTC ATCAGACGTA GAGCGATGCA GATCCGGAGA GCTGCCATTG
TGTCCTCCAT CCAAGACCTA CTCCGCCACC CTGATAAGGG GACTAATGGA AGGGAAGCAC CTGGATGCAG ATGCGGCCGC
TAGTTACATC AACACTGCAG CTACCAGAGG CCTGTGAAGG CTGCTTCCCT ATGCATTATG GTTTGTAGTT TTGCACTAAG
CATGTAAGTG GCTAACCCAC GAATCCACTT ATTTTCACTT ATAAGTGGGT TTGCAGATTA GCCACTTACG CGCTTAGTTT
GTACAGCCAG TAGGAGCGTA CTAGGACTGT AGGAGGAATG ATGAGTAGGT TTGCAGGACT GTAAAGATAG TGCGTTGATC
ATTCAGGACC ACGGGGGCTT ATGTAGAGGC CTCGTGAATG TCCTGCCAAT TGGGGAATCT GGACCCGATC AAGTTTCCCT
AGGATTGTTA AGAATCTAGC TAGCGCTTGT ACCCTGGGTT GGTCATTGTC TCATTGGTGC TCTCCGGATT GGTTTGTTTT
GGGGTGGAAA AAAAAACACT AGTCGATGTT GCCTGGTTTT TCATGCTGTT ACCTGGCGAG GAAATGACGA TTTCTTGTG