Os08t0366000-01

Locus

Os08g0366000

Description

Phosphoenolpyruvate carboxylase.

Transcript Evidence

AK073703 (DDBJ, Best hit)

Protein Evidence

Q84XH0 (UniProt)

CGSNL Gene Symbol

CGSNL Gene Name

CGSNL Gene Symbol Synonym(s)

CGSNL Gene Name Synonym(s)

Literature (PMID)

Manual Curation

Note

GO

Biological Process: tricarboxylic acid cycle (GO:0006099)

Biological Process: carbon fixation (GO:0015977)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: phosphoenolpyruvate carboxylase activity (GO:0008964)

InterPro

Pyruvate/Phosphoenolpyruvate kinase (IPR015813)

Phosphoenolpyruvate carboxylase, active site (IPR018129)

Phosphoenolpyruvate carboxylase (IPR021135)

Phosphoenolpyruvate carboxylase, bacterial/plant-type (IPR022805)

KEGG

Os08t0366000-01 (EC:4.1.1.31)

KOME

J033055B18 (Online Clone Ordering)

RiceXPro Database

AK073703

Plant Gene Family Database (PGFD)

Os08t0366000-01

Transcript

3535 bp

>Os08t0366000-01 Phosphoenolpyruvate carboxylase.
AGGTGGAAGAGACGGACAGAGGCCACTACCCGTGCACCACGCCCCCTCTCCCACAATCTC
GCAAAAAAGTTGATTTTCTTTTTCAGCTTCCTCCTCCCCTCCTCCGCTTCTCATCAATCC
ACTAGCATATCAGATCAGATTCCTGTACACTTCCCTTTCCTCGCATCCAATCCCGACTAT
CAAATCATCACCATCCTTTTGCAAAACCAAAAAAAAAAAAGTAGATAAAAGAAGAAGGTT
CTTGCATCCAAGAGAGGAGGACACTGTCCGTCGTGCAGCGTTTCTTGCTTGGTTGAATCG
GGTGGTTTTGGGGGGGATGGCGGGGAAGGTGGAGAAGATGGCGTCGATCGACGCGCAGCT
GCGGATGCTGGCGCCGGCGAAGCTGTCGGAGGACGACAAGCTGGTGGAGTACGACGCCCT
CCTCCTCGACCGCTTCCTCGACATCCTCCAGGACCTCCACGGCGACGACCTCCGCGAGCT
GGTCCAAGAATGCTATGAGATCGCTGCTGAGTATGAAGGGAAGCATGACTCCCAAAAGCT
CGATGAACTTGGCAACATGTTGACAAGCTTGGATCCTGGTGACTCCATTGTGATGGCCAA
AGCTTTCTCCCACATGCTTAATTTGGCTAACTTGGCCGAGGAGGTCCAGATTGCATACAG
GAGGAGAATCAAGCTCAAGAAGGGTGACTTTGCTGATGAGAACTCGGCACTGACAGAATC
TGACATTGAAGAAACTTTTAAGAGGCTTGTTGTTGACCTGAAGAAATCACCAGCAGAGGT
CTTTGATGCCCTTAAGAGTCAGACTGTTGACCTGGTTTTGACTGCACATCCAACACAGTC
AGTGAGGAGGTCACTGCTTCAAAAACACTCAAGGATAAGGAATTGTTTGGTTCAACTATA
CTCAAAGGATATCACACCAGATGATAAACAGGAGCTTGATGAGGCTCTCCAGAGGGAGAT
TCAAGCAGCCTTTAGAACTGATGAGATCCGAAGAACCCAGCCAACTCCTCAAGATGAAAT
GAGGGCTGGTATGAGTTACTTTCATGAGACAATCTGGAAAGGTGTTCCGAAGTTCTTACG
CCGTCTGGACACTGCCTTGAAGAACATCGGAATTGATGAGCGTGTTCCTTATAATGCACC
TCTCATTCAGTTCTCTTCTTGGATGGGAGGAGACCGTGATGGAAATCCAAGAGTGACACC
AGAAGTCACAAGGGATGTATGCTTGCTTGCTAGAATGATGGCTTCAAATTTATACTGCTC
GCAAATTGAGGATCTCATGTTTGAGCTGTCTATGTGGCGATGCAATGATGAGCTTCGGGC
ACGAGCAGATGAGCTGCATCTCTCCTCAAAGAAAGATGCAAAGCACTATATAGAATTCTG
GAAGAAGGTTCCGCCCAGTGAGCCATACCGAGTTGTTCTAGGTGATGTGAGAGACAAGCT
GTACAACACACGTGAACGAGCACGCCAGTTATTATCCAGCGGATATTCTGACATTCCTGA
AGAAACCACTCTCACCAGTGTTGAACAGTTCTTAGAGCCTCTGGAGCTATGTTACAGGTC
ACTCTGCGATTGCGGTGACCGTGTAATTGCTGATGGGACCCTTCTGGACTTCTTGCGCCA
GGTGTCTACCTTTGGGCTGTGCCTTGTGAGGCTTGACATTAGGCAAGAATCTGACAGGCA
CACCGATGTCCTCGATGCCATCACCACATACCTGGGAATAGGATCATACCGTGAGTGGTC
CGAGGAACGCCGTCAGGACTGGCTCTTGTCTGAACTCAATGGGAAGCGCCCATTGTTTGG
CCCAGACCTTCCCAAGACCGATGAGATTGCTGACGTTCTAGACACGTTCCGCGTGATAGC
TGAGCTTCCCGCTGACAATTTTGGGGCCTATATCATTTCCATGGCGACAGCTCCGTCAGA
CGTGCTTGCTGTTGAGCTCCTCCAACGTGAATGCCATGTGAAGACACCACTTAGAGTTGT
CCCACTGTTTGAGAAGTTGGCTGATCTTGAATCTGCCCCAGCAGCAGTGGCCAGACTGTT
CTCCATAGATTGGTACAGAGAAAGGATAAATGGCAAACAGGAGGTCATGATTGGCTATTC
GGACTCGGGTAAGGACGCCGGTCGTCTCTCGGCAGCTTGGCAGCTGTACAAGTCTCAGGA
GGAGCTCATCAACGTTGCCAAGGAGTTTGGGGTGAAGTTGACAATGTTCCATGGGCGCGG
TGGGACTGTCGGAAGAGGCGGAGGTCCCACTCATCTTGCCATCTTGTCTCAGCCACCAGA
CACAATCCATGGATCTCTCCGGGTCACTGTCCAGGGTGAAGTCATTGAGCAGTCCTTTGG
TGAGGAGCACCTTTGCTTCAGGACACTGCAGCGTTTCACGGCTGCCACTCTGGAGCATGG
CATGCATCCACCAATTGCGCCGAAACCAGAATGGCGTGCTCTGCTTGATGAGATGGCTGT
GGTGGCTACAAAGGAATACCGGTCCATCGTCTTCCAGGAACCACGCTTTGTCGAGTATTT
CCGCCTTGCAACACCAGAGATGGAGTATGGAAGGATGAATATAGGAAGCAGGCCATCCAA
GAGAAAGCCGAGTGGTGGCATCGAGTCACTCCGTGCCATCCCATGGATCTTCGCGTGGAC
GCAAACTCGCTTCCACCTTCCTGTCTGGCTTGGCTTCGGTTCTGCCTTCAAGCACATCCT
GGAGAAGGACATCAGGAACCTCCACATGCTCCAGGAGATGTACAATGAGTGGCCGTTCTT
CAGAGTCACGATCGATCTGGTTGAGATGGTTTTCGCCAAGGGTGACCCTGGCATCGCCGC
ATTGTACGACAAGCTCCTTGTCTCCGAGGAGCTATGGCCTCTGGGAGAGAAACTGAGGGC
CAACTGTGAAGAAACCAAACAGCTTCTCCTTCAGGTTGCTGGACACAAGGATCTTCTCGA
AGGTGATCTCTACCTGAAGCAGCGCCTTCGCCTCCGCAATGCCTACATCACCACCCTGAA
TGTCTGCCAGGCTTACACGATGAAGCGAATCCGCGACCCGGACTACCATGTCACGCTGCG
CCCCCACATGTCCAAGGAGATCATGGACTGGTCTAAGCCGGCTGCGGAGCTGGTGAAGCT
GAACCCGACCAGTGAGTATGCGCCGGGGCTGGAGGACACCCTCATCCTGACCATGAAGGG
AATTGCTGCTGGAATGCAGAACACCGGCTAAGCGAACTATCAACTATGAAGTGCCTGAAT
TCACACCGTTTTATATGGACTCTTATCTTGATTTCGGTCATTTGCTCTCGGCCATTTAAT
TTTGCCGATGCAGAGGCTCGTGCAGTTTCTAATTTCTTTCGGAAGATATTTTCAATAATG
GAGTTGTACAAGAACATCAATTAATCAAAATAAAGTGGATATTATGTTCATTATCGTTTA
GAGCAACCTGGTAAAGCCATTTTTTTGTGTAGACCACATAGTGAGTGTGTTGAAATTCCA
TTTGCTTAATGAAACTGCCATTATCTAAGTAAAGTCAAAGGGCTCCTTTATATTG

CDS

2895 bp

>Os08t0366000-01 Phosphoenolpyruvate carboxylase.
ATGGCGGGGAAGGTGGAGAAGATGGCGTCGATCGACGCGCAGCTGCGGATGCTGGCGCCG
GCGAAGCTGTCGGAGGACGACAAGCTGGTGGAGTACGACGCCCTCCTCCTCGACCGCTTC
CTCGACATCCTCCAGGACCTCCACGGCGACGACCTCCGCGAGCTGGTCCAAGAATGCTAT
GAGATCGCTGCTGAGTATGAAGGGAAGCATGACTCCCAAAAGCTCGATGAACTTGGCAAC
ATGTTGACAAGCTTGGATCCTGGTGACTCCATTGTGATGGCCAAAGCTTTCTCCCACATG
CTTAATTTGGCTAACTTGGCCGAGGAGGTCCAGATTGCATACAGGAGGAGAATCAAGCTC
AAGAAGGGTGACTTTGCTGATGAGAACTCGGCACTGACAGAATCTGACATTGAAGAAACT
TTTAAGAGGCTTGTTGTTGACCTGAAGAAATCACCAGCAGAGGTCTTTGATGCCCTTAAG
AGTCAGACTGTTGACCTGGTTTTGACTGCACATCCAACACAGTCAGTGAGGAGGTCACTG
CTTCAAAAACACTCAAGGATAAGGAATTGTTTGGTTCAACTATACTCAAAGGATATCACA
CCAGATGATAAACAGGAGCTTGATGAGGCTCTCCAGAGGGAGATTCAAGCAGCCTTTAGA
ACTGATGAGATCCGAAGAACCCAGCCAACTCCTCAAGATGAAATGAGGGCTGGTATGAGT
TACTTTCATGAGACAATCTGGAAAGGTGTTCCGAAGTTCTTACGCCGTCTGGACACTGCC
TTGAAGAACATCGGAATTGATGAGCGTGTTCCTTATAATGCACCTCTCATTCAGTTCTCT
TCTTGGATGGGAGGAGACCGTGATGGAAATCCAAGAGTGACACCAGAAGTCACAAGGGAT
GTATGCTTGCTTGCTAGAATGATGGCTTCAAATTTATACTGCTCGCAAATTGAGGATCTC
ATGTTTGAGCTGTCTATGTGGCGATGCAATGATGAGCTTCGGGCACGAGCAGATGAGCTG
CATCTCTCCTCAAAGAAAGATGCAAAGCACTATATAGAATTCTGGAAGAAGGTTCCGCCC
AGTGAGCCATACCGAGTTGTTCTAGGTGATGTGAGAGACAAGCTGTACAACACACGTGAA
CGAGCACGCCAGTTATTATCCAGCGGATATTCTGACATTCCTGAAGAAACCACTCTCACC
AGTGTTGAACAGTTCTTAGAGCCTCTGGAGCTATGTTACAGGTCACTCTGCGATTGCGGT
GACCGTGTAATTGCTGATGGGACCCTTCTGGACTTCTTGCGCCAGGTGTCTACCTTTGGG
CTGTGCCTTGTGAGGCTTGACATTAGGCAAGAATCTGACAGGCACACCGATGTCCTCGAT
GCCATCACCACATACCTGGGAATAGGATCATACCGTGAGTGGTCCGAGGAACGCCGTCAG
GACTGGCTCTTGTCTGAACTCAATGGGAAGCGCCCATTGTTTGGCCCAGACCTTCCCAAG
ACCGATGAGATTGCTGACGTTCTAGACACGTTCCGCGTGATAGCTGAGCTTCCCGCTGAC
AATTTTGGGGCCTATATCATTTCCATGGCGACAGCTCCGTCAGACGTGCTTGCTGTTGAG
CTCCTCCAACGTGAATGCCATGTGAAGACACCACTTAGAGTTGTCCCACTGTTTGAGAAG
TTGGCTGATCTTGAATCTGCCCCAGCAGCAGTGGCCAGACTGTTCTCCATAGATTGGTAC
AGAGAAAGGATAAATGGCAAACAGGAGGTCATGATTGGCTATTCGGACTCGGGTAAGGAC
GCCGGTCGTCTCTCGGCAGCTTGGCAGCTGTACAAGTCTCAGGAGGAGCTCATCAACGTT
GCCAAGGAGTTTGGGGTGAAGTTGACAATGTTCCATGGGCGCGGTGGGACTGTCGGAAGA
GGCGGAGGTCCCACTCATCTTGCCATCTTGTCTCAGCCACCAGACACAATCCATGGATCT
CTCCGGGTCACTGTCCAGGGTGAAGTCATTGAGCAGTCCTTTGGTGAGGAGCACCTTTGC
TTCAGGACACTGCAGCGTTTCACGGCTGCCACTCTGGAGCATGGCATGCATCCACCAATT
GCGCCGAAACCAGAATGGCGTGCTCTGCTTGATGAGATGGCTGTGGTGGCTACAAAGGAA
TACCGGTCCATCGTCTTCCAGGAACCACGCTTTGTCGAGTATTTCCGCCTTGCAACACCA
GAGATGGAGTATGGAAGGATGAATATAGGAAGCAGGCCATCCAAGAGAAAGCCGAGTGGT
GGCATCGAGTCACTCCGTGCCATCCCATGGATCTTCGCGTGGACGCAAACTCGCTTCCAC
CTTCCTGTCTGGCTTGGCTTCGGTTCTGCCTTCAAGCACATCCTGGAGAAGGACATCAGG
AACCTCCACATGCTCCAGGAGATGTACAATGAGTGGCCGTTCTTCAGAGTCACGATCGAT
CTGGTTGAGATGGTTTTCGCCAAGGGTGACCCTGGCATCGCCGCATTGTACGACAAGCTC
CTTGTCTCCGAGGAGCTATGGCCTCTGGGAGAGAAACTGAGGGCCAACTGTGAAGAAACC
AAACAGCTTCTCCTTCAGGTTGCTGGACACAAGGATCTTCTCGAAGGTGATCTCTACCTG
AAGCAGCGCCTTCGCCTCCGCAATGCCTACATCACCACCCTGAATGTCTGCCAGGCTTAC
ACGATGAAGCGAATCCGCGACCCGGACTACCATGTCACGCTGCGCCCCCACATGTCCAAG
GAGATCATGGACTGGTCTAAGCCGGCTGCGGAGCTGGTGAAGCTGAACCCGACCAGTGAG
TATGCGCCGGGGCTGGAGGACACCCTCATCCTGACCATGAAGGGAATTGCTGCTGGAATG
CAGAACACCGGCTAA

Protein

965 aa

>Os08t0366000-01 Phosphoenolpyruvate carboxylase.
MAGKVEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGDDLRELVQECY
EIAAEYEGKHDSQKLDELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKL
KKGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDALKSQTVDLVLTAHPTQSVRRSL
LQKHSRIRNCLVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMS
YFHETIWKGVPKFLRRLDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRD
VCLLARMMASNLYCSQIEDLMFELSMWRCNDELRARADELHLSSKKDAKHYIEFWKKVPP
SEPYRVVLGDVRDKLYNTRERARQLLSSGYSDIPEETTLTSVEQFLEPLELCYRSLCDCG
DRVIADGTLLDFLRQVSTFGLCLVRLDIRQESDRHTDVLDAITTYLGIGSYREWSEERRQ
DWLLSELNGKRPLFGPDLPKTDEIADVLDTFRVIAELPADNFGAYIISMATAPSDVLAVE
LLQRECHVKTPLRVVPLFEKLADLESAPAAVARLFSIDWYRERINGKQEVMIGYSDSGKD
AGRLSAAWQLYKSQEELINVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGS
LRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPIAPKPEWRALLDEMAVVATKE
YRSIVFQEPRFVEYFRLATPEMEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFH
LPVWLGFGSAFKHILEKDIRNLHMLQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDKL
LVSEELWPLGEKLRANCEETKQLLLQVAGHKDLLEGDLYLKQRLRLRNAYITTLNVCQAY
TMKRIRDPDYHVTLRPHMSKEIMDWSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAGM
QNTG*

5'UTR

chr08:16970248..16970563 (- strand) : 316 bp

CDS

chr08:16970083..16970247 (- strand) : 165 bp

chr08:16968248..16968639 (- strand) : 392 bp

chr08:16968081..16968165 (- strand) : 85 bp

chr08:16967666..16967888 (- strand) : 223 bp

chr08:16967483..16967586 (- strand) : 104 bp

chr08:16967324..16967411 (- strand) : 88 bp

chr08:16967082..16967236 (- strand) : 155 bp

chr08:16965979..16966977 (- strand) : 999 bp

chr08:16965457..16965843 (- strand) : 387 bp

chr08:16965035..16965331 (- strand) : 297 bp

3'UTR

chr08:16964711..16965034 (- strand) : 324 bp

FASTA

>Os08t0366000-01 class=Sequence position=chr08:16964711..16970563 (- strand)
AGGTGGAAGA GACGGACAGA GGCCACTACC CGTGCACCAC GCCCCCTCTC CCACAATCTC GCAAAAAAGT TGATTTTCTT
TTTCAGCTTC CTCCTCCCCT CCTCCGCTTC TCATCAATCC ACTAGCATAT CAGATCAGAT TCCTGTACAC TTCCCTTTCC
TCGCATCCAA TCCCGACTAT CAAATCATCA CCATCCTTTT GCAAAACCAA AAAAAAAAAA GTAGATAAAA GAAGAAGGTT
CTTGCATCCA AGAGAGGAGG ACACTGTCCG TCGTGCAGCG TTTCTTGCTT GGTTGAATCG GGTGGTTTTG GGGGGGATGG
CGGGGAAGGT GGAGAAGATG GCGTCGATCG ACGCGCAGCT GCGGATGCTG GCGCCGGCGA AGCTGTCGGA GGACGACAAG
CTGGTGGAGT ACGACGCCCT CCTCCTCGAC CGCTTCCTCG ACATCCTCCA GGACCTCCAC GGCGACGACC TCCGCGAGCT
GGTATGCTGG TGCTACTCTC TCTATTCGAT CCCCAATGAC TGATTAAATC TTTTTCATCA TCTGCTACTC CTACTCTGCT
ACCTGCATGT TCATGCTCCA GATCAGCAGA TAATGCTTGC TTGTTTGCTT GCTGCCTGCG TGTGCGCGCT TGTGAATATC
TTCTTTTTTT TTAATGGAGT GATTTGGTTG CTTGTGGACT GATTGACTGA CTCACTCACT GAATGATTGG ATTAGCTTTT
GTGAGTGGGA TTGTGGGGAT TCTGTGCTTC AGCATAATTG GAACATGGAG AGTGCCCATG TTTTTGGGGG TGCTTTCTGC
TTTTTCTTTA TTTTAATTTG GGGGTAAAAA ACCAAAATAT TCCAACAGTT TCTTCCTTTA TTTTTTAGTT TGTCGGTTGA
CAAGTTGGTG CTTCCAGTGA GGGTACTGAG TGGAGTTTTC GTTCTGGGGC CTGCCCCTTT CTTCTTCTTC TTTTTTAGAG
TATTCGGATT ATGTTTCTGG GTTAAAATAT GTGTTTGAAT TATTGTGTTC GTATAATGGA AATTCAGAAA AAAAACTGGC
ATCTTTTGCA TTTGGAGCTG TTTTCCAGGG GTGTATGTAC TGAAATCTGA ATATTTACTG TTTGAGTCAA ATCTGAGCTG
AACTTTAATT ATCTATCCTG AATTCCTGAT TGATTAACAA CTGCCACTTT GTATAAACAA CAGTTTCATA GACATCCATC
GTAACTGAAC ACTTCATTTT TATCAAATTT TAAGCAGAGG AAGTCAAAGA CATGGGTGTC AAATGTTTGT GTTTTTTATT
TTTGTTGTTT CGTCAAACTG AATGTGACAT GTACTCATTA GTTGGATCTT TAGGATATCA GGAAATGACA ACTGTATATT
AAAAGTTTTA TATTGACAAA CCAACATGAA TTCTTTGGTA TTGCTAGAGC CTTGCTTAAG TACTTACTCC TGTGCAAAAA
TTTTGAGGTT TAGTGCCCTA GTGTGCTCAG GTTTGGTGCT TTTGTATTTG AAGTCTTCAT TTGCAGACGT GGCTGCAATT
TTTTATAGAA GGGTAAATTG TGAATGAAAT CTGAGTTGAT CTTTAATTGT ATATTCTGTA TATCTATCAA CCACTTTAAT
GATTACAACA AAAATTCCAG CTTTACATGA ACATGCCATG AACTTCCGTT GAAAGTGAAT AACTTGGCTT TGTCAGTTCC
CCGTGTGGCC AATGTTCATG CACGAGACTA ATATTGAATA CAATTTGTTT TGTCAAAATA AACTGATACC TTTGTTGCAG
ACCCTTCCAT GGATGTATGA CAAGGAATTT TTTTTTTACT TTGATGTATA GTCAATTAGT TTGATTTTTT TTTGTTCTGA
ATTGATTGGA AAATAATGCC TGTATTTACA ATTTTATATC AACGGAAAAA CCATGGATTG CTAATTTGTT ATTGATATGT
GTAGGTCCAA GAATGCTATG AGATCGCTGC TGAGTATGAA GGGAAGCATG ACTCCCAAAA GCTCGATGAA CTTGGCAACA
TGTTGACAAG CTTGGATCCT GGTGACTCCA TTGTGATGGC CAAAGCTTTC TCCCACATGC TTAATTTGGC TAACTTGGCC
GAGGAGGTCC AGATTGCATA CAGGAGGAGA ATCAAGCTCA AGAAGGGTGA CTTTGCTGAT GAGAACTCGG CACTGACAGA
ATCTGACATT GAAGAAACTT TTAAGAGGCT TGTTGTTGAC CTGAAGAAAT CACCAGCAGA GGTCTTTGAT GCCCTTAAGA
GTCAGACTGT TGACCTGGTT TTGACTGCAC ATCCAACACA GTCAGTGAGG AGGTCACTGC TTCAAAAACA CTCAAGGTGA
GTTACAGAAA CAATACTATG ATATCAAACA TCCTATGGTT TCTTATCATC TAATTGTGAA ATTTCAAATA TAATTTAGGA
TAAGGAATTG TTTGGTTCAA CTATACTCAA AGGATATCAC ACCAGATGAT AAACAGGAGC TTGATGAGGC TCTCCAGAGG
GAGGTAAGAT AATCAAGTTA ATCACTGACT CATTTATAGT CTTGATTTTT TTTTTCAAAT TGTATGTGCC TTTTCGATTA
TTTATAGAAA TTATAAATTA CTTTCAGCAT GATGCTCAAC ATGCCAGATT TTGTGCTCCA ACTAAATTTA TTAATGCATT
AATAAGGTGA ATCAGAACAT GTTCTTATTT TTCAGATTCA AGCAGCCTTT AGAACTGATG AGATCCGAAG AACCCAGCCA
ACTCCTCAAG ATGAAATGAG GGCTGGTATG AGTTACTTTC ATGAGACAAT CTGGAAAGGT GTTCCGAAGT TCTTACGCCG
TCTGGACACT GCCTTGAAGA ACATCGGAAT TGATGAGCGT GTTCCTTATA ATGCACCTCT CATTCAGTTC TCTTCTTGGA
TGGGAGGAGA CCGTGATGGT ATGCAAAGGA TGGCTTTTGA CTTCTGTATA GTTCAGTTCT TGTGCATTTA ATAATTTTGT
GCATTGCACC AATTTAGGAA ATCCAAGAGT GACACCAGAA GTCACAAGGG ATGTATGCTT GCTTGCTAGA ATGATGGCTT
CAAATTTATA CTGCTCGCAA ATTGAGGATC TCATGTTTGA GGTAAGAATT ACTTCATCCC TTATCTTCCA CACATATAAA
TCAATTTTAT TAAATTCTCC AAATTCTGGC AGCTGTCTAT GTGGCGATGC AATGATGAGC TTCGGGCACG AGCAGATGAG
CTGCATCTCT CCTCAAAGAA AGATGCAAAG CACTATATAG GTAAATATCG ACTACCCATT TTAATAGTGA TGGCTATCTG
TTATGATTGA CAATGTTGGC ATAATATCGT TTCCTTGTTC GTCTTAGAAT TCTGGAAGAA GGTTCCGCCC AGTGAGCCAT
ACCGAGTTGT TCTAGGTGAT GTGAGAGACA AGCTGTACAA CACACGTGAA CGAGCACGCC AGTTATTATC CAGCGGATAT
TCTGACATTC CTGAAGAAAC CACTCTCACC AGTGTTGAAC AGGTAAAGTA TTGATCAAAG AACCATTGGA TGCTTGTAAC
TCTGAAATGG GCATTCTTTC TTCATCACCT TTGTTCTTAA GTCTAAACAA CTGTCTTACC TTGCAGTTCT TAGAGCCTCT
GGAGCTATGT TACAGGTCAC TCTGCGATTG CGGTGACCGT GTAATTGCTG ATGGGACCCT TCTGGACTTC TTGCGCCAGG
TGTCTACCTT TGGGCTGTGC CTTGTGAGGC TTGACATTAG GCAAGAATCT GACAGGCACA CCGATGTCCT CGATGCCATC
ACCACATACC TGGGAATAGG ATCATACCGT GAGTGGTCCG AGGAACGCCG TCAGGACTGG CTCTTGTCTG AACTCAATGG
GAAGCGCCCA TTGTTTGGCC CAGACCTTCC CAAGACCGAT GAGATTGCTG ACGTTCTAGA CACGTTCCGC GTGATAGCTG
AGCTTCCCGC TGACAATTTT GGGGCCTATA TCATTTCCAT GGCGACAGCT CCGTCAGACG TGCTTGCTGT TGAGCTCCTC
CAACGTGAAT GCCATGTGAA GACACCACTT AGAGTTGTCC CACTGTTTGA GAAGTTGGCT GATCTTGAAT CTGCCCCAGC
AGCAGTGGCC AGACTGTTCT CCATAGATTG GTACAGAGAA AGGATAAATG GCAAACAGGA GGTCATGATT GGCTATTCGG
ACTCGGGTAA GGACGCCGGT CGTCTCTCGG CAGCTTGGCA GCTGTACAAG TCTCAGGAGG AGCTCATCAA CGTTGCCAAG
GAGTTTGGGG TGAAGTTGAC AATGTTCCAT GGGCGCGGTG GGACTGTCGG AAGAGGCGGA GGTCCCACTC ATCTTGCCAT
CTTGTCTCAG CCACCAGACA CAATCCATGG ATCTCTCCGG GTCACTGTCC AGGGTGAAGT CATTGAGCAG TCCTTTGGTG
AGGAGCACCT TTGCTTCAGG ACACTGCAGC GTTTCACGGC TGCCACTCTG GAGCATGGCA TGCATCCACC AATTGCGCCG
AAACCAGAAT GGCGTGCTCT GCTTGATGAG ATGGCTGTGG TGGCTACAAA GGAATACCGG TCCATCGTCT TCCAGGAACC
ACGCTTTGTC GAGTATTTCC GCCTTGTGAG TGTTTTGTTT CTTCATAATC ATCAGACTTG GAACATTTCA TATAATGCAT
TTAAGGCACT TAGCTAAACA TTGTTCATTT CAGGCAAAAC CTTTGTAAAT TAATTTTCTT TACATTTTTC ATGAAATCAG
GCAACACCAG AGATGGAGTA TGGAAGGATG AATATAGGAA GCAGGCCATC CAAGAGAAAG CCGAGTGGTG GCATCGAGTC
ACTCCGTGCC ATCCCATGGA TCTTCGCGTG GACGCAAACT CGCTTCCACC TTCCTGTCTG GCTTGGCTTC GGTTCTGCCT
TCAAGCACAT CCTGGAGAAG GACATCAGGA ACCTCCACAT GCTCCAGGAG ATGTACAATG AGTGGCCGTT CTTCAGAGTC
ACGATCGATC TGGTTGAGAT GGTTTTCGCC AAGGGTGACC CTGGCATCGC CGCATTGTAC GACAAGCTCC TTGTCTCCGA
GGAGCTATGG CCTCTGGGAG AGAAACTGAG GGCCAACTGT GAAGAAACCA AACAGCTTCT CCTTCAGGTG CGTCGACTGA
CCTTGCTAGA GCTGATTACA CTTTGGAAAC CAATGATGCA ACATCTATGA GATACTGAAA TGTTCCATTG TCATTCACTC
AATGAAATTC TTTGGCCACT TTTGACCTTC AGGTTGCTGG ACACAAGGAT CTTCTCGAAG GTGATCTCTA CCTGAAGCAG
CGCCTTCGCC TCCGCAATGC CTACATCACC ACCCTGAATG TCTGCCAGGC TTACACGATG AAGCGAATCC GCGACCCGGA
CTACCATGTC ACGCTGCGCC CCCACATGTC CAAGGAGATC ATGGACTGGT CTAAGCCGGC TGCGGAGCTG GTGAAGCTGA
ACCCGACCAG TGAGTATGCG CCGGGGCTGG AGGACACCCT CATCCTGACC ATGAAGGGAA TTGCTGCTGG AATGCAGAAC
ACCGGCTAAG CGAACTATCA ACTATGAAGT GCCTGAATTC ACACCGTTTT ATATGGACTC TTATCTTGAT TTCGGTCATT
TGCTCTCGGC CATTTAATTT TGCCGATGCA GAGGCTCGTG CAGTTTCTAA TTTCTTTCGG AAGATATTTT CAATAATGGA
GTTGTACAAG AACATCAATT AATCAAAATA AAGTGGATAT TATGTTCATT ATCGTTTAGA GCAACCTGGT AAAGCCATTT
TTTTGTGTAG ACCACATAGT GAGTGTGTTG AAATTCCATT TGCTTAATGA AACTGCCATT ATCTAAGTAA AGTCAAAGGG
CTCCTTTATA TTG