Os08t0400200-00

Locus

Os08g0400200

Description

Similar to SET domain protein.

Transcript Evidence

ab initio prediction

Protein Evidence

Q6Z2A2 (UniProt)

CGSNL Gene Symbol

_

CGSNL Gene Name

_

CGSNL Gene Symbol Synonym(s)

OsSET30, SDG710, OsSUVH10

CGSNL Gene Name Synonym(s)

SET protein 30, SUVH Histone Methyltransferase 10

Literature (PMID)

Manual Curation

Note

Gene structure and sequnce have changed between Build5 and IRGSP-1.0 assemblies.

GO

Biological Process: histone lysine methylation (GO:0034968)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: histone-lysine N-methyltransferase activity (GO:0018024)

Molecular Function: histone binding (GO:0042393)

InterPro

SET domain (IPR001214)

SRA-YDG (IPR003105)

Post-SET domain (IPR003616)

Pre-SET domain (IPR007728)

Oryzabase

13394

Plant Gene Family Database (PGFD)

Os08t0400200-00

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os08t0400200-00

Transcript

3522 bp

>Os08t0400200-00 Similar to SET domain protein.
ATGGACGGGCCGACGCTGGAACTCTCCGAGATGATGCTCCACGCGGCGCAGCCATGGAGA
AGCCGATGCACGCAGCGTGACGTTCGCCCGGGCGCGGTTCCTCCTCGTCCCGTCGCTGCG
GATGGGCGAGGCGAGGGCACCAGTACAGTGCGAGGGCGCGTGCTGGAGGGGACGACTCGT
GGTGGAGGCAGAGGAGGTGGAATGGAGCGTGAGCGCGAGGTGGTGGCGCCGGCGAGAAAT
GCGGTGGCCGTCGCCGGTGATTTGGCCACGCACGGCGGCGAGCGGGTTGCTGGCCCCTTG
GTGGCGAAGGAGAAGAGAAATGGCGGCGGTGAGTTGGGGACGAAGAGGGGGCTAGAGAAG
CGGGCCCCGCTTCCGCCGCCCAAGCGCAGGGTGGTGTCCGCTAAGCGCCAGTTTCCACCA
GATTTCGGTAGGGACTCTGCTGTTCCACTCGGCCGCGGCCGGGGCCGTGGTGGTGGTGTT
CGTCCGTCGGATGGGGCGCCTGCCCGTGCTGTTCTGGGTGAGAAGGTGGCGTCTGCGGGT
AATGGTGATTCAATGGCGAATGTGCATCATCATGCTGTGATGGACACGGTCTTGATGAAA
TCTTCACATGCTTCGGATGAGAATCTGGTTGCTTTCAAAGTTGGTTCACCAGAGAATGGT
GCAGAAGGGGCAGCAAGGGGAAAGGGAGCACACAATGGTGAATTGCTGGGAAAGAGGGAA
GTGTTGGCTCAAGCTGTGAATTTGCTTCCCATGAGGAGGACTGTATCTGCGACGCACCGC
TTCACTGCTGGGTGTGGGAGGGACGCTGCAGCTCCACTTGCTCGCAGAGAAGAGGGTAAG
GTGGGTTCAGGTTTGGAAGTCATGCCTGTTGATGTTGGTGGGGGTGTGTCAAAGGAGGTG
ATGGCTACGGATGGCAGTAAACATTCGGTTAACCAGTGTACGGCGAACATTGTTGGAGCT
GTCGGTGTTTTGGATGGAACAGTACAGTACCAGGAATTGGAGGAGGGTGAGGTGGCTGAT
GAGGCATACTGTGATGTAGAGTCACAAAAAGTTGTTGGTTGTGATTCTTTTGATGATTCT
GCAGGTGAAAGACATGAGGGTGTTGTTCCTGTAACGTTTGCTGTTACTGAAGTTTTGACA
AGTCACGCTTATGATGAGATGATGCAAATTAAGGCATTGCAAGAAGGGGGCAGTGATGCT
GCGCAGGAAACTGAACATGACTTGCCAATGGGAGGCAAATGTGAAACTATCTTACCTGAT
GCTTCTCCTAAATGTTCGTTTGGTGGTCCTTCAAATGAAATTGTCCACGGCAAGAGAGTG
TTGGGGAGTCATGGCATGAAAGGGGAAGTTCCCAGTCTTGCAATTGAAGATCATGGTGGC
ATTGCTCAAATTGACCAAGAACTGGAGGACGTTGAGATGACTACAGGGGAATACCGTGTT
CAGGATGCTCAAATTGCCACCCATGTTATCCCACACGAGTCTACAACTGGTAGACATGAG
GGGGGGCTTTGTGCATCTGCAGCTGCTGAAGATGTTAAGGTGATGAACAAATACAAAGGG
ACCTTACCCAAAGGTGCTGCTAAATCATCGATGAATATTGCAACAGGAGTATTTGGTGAT
GGTATCATGAGAAGTAAGATACTATCAACAGCTAGAAAAGTAGTCAAGCCACCTGTCAGA
GCAAGCCATAAGCCTCCATTGAACACTCTGCATAGACCCTTCTCCACAAATAGTGCTTCA
TTTGGTCATAAGAAGTTGAAGGTAAAACGTCCAGATCAAAGTAAAGATATTCCTATGAAG
ATTGCCTCTACATCTGGATTGGCGGGCAAGGACAACCTTATCGATGAAAAGGCTTTGAGC
TTGGAAGATGATGATATTTTGAAGGCACTAGTTGTTCATGATGGAAAGCTTGAGGTGTAT
CTCAATGTTCCCTCATGCGTTCAGCTTCATAGGCAACATGGAAGTGGGAATGCTGATGAT
AGGAGCAAAATCAGGATGTTGTGCAGGAGGTTTCAGTTTATATGCAGGGCTCTCTTACAT
GCCGTCGAACAGGGTTCATTGAAGATTCGAAGAGTTGACCTTGCAGCTGATAAAATCATC
AGGAAATTGCCAGGCTTTACCAAACCTGGACCTACTGTGGGAAATGTTAATGGAGTGGAA
GTTGGTGACGAATTTATGTACAGAGTTGAGCTAGCCCTTGTTGGTCTCCATCGCCCATAC
CAGGGAGGAATTGATACCACCGATTATAATGGAGTGCTTGTTGCAATAAGCATCGTTTGT
TCTGGAGGTTATCCTGATGAATTGTCAAGCTCAGGTGAACTAATATACACTGGTTCTGGA
GGAAAGCCTGCTGGTAAGAAGAAAGATGAGGATCAAAAGCTAGAGAGGGGGAACCTTGCC
TTGAAGAATTGCATCGAGACAAAGACACCTGTCCGAGTGATTCATGGATTCAAAGGTCAA
AATAGAGAGGACAACAGTCATTCAAGAGCTAAACAAATCCTAACATTTACTTATGATGGG
TTGTACCTTGTGGTGGATTGCTGGACAGAAGGACTAAAAGGTTCAAGGATCTTCAAATAC
AAATTACAAAGGATTCCTGGACAACCAGAACTTCCTCTGCACATAGCTAAAGGGCTGAGA
AGGTCTCTTTCACGTCCAGGCCTCTGCATAGCTGATATATCTCAAGGGAAAGAAATGGAT
CCCATCTGTGTGATCAATGATGTTAGTAATGTCCATCCAACATCTTTTCAGTACATCTCT
AGAATCAAGTACCCGTCATGGCTTACAAAAAGACATCCTCAGCATCATGGTTGCGATTGC
TCAGATGGCTGCATAGATTCTACTAAGTGCTTTTGTGCTGTGAAGAATGGAGGAAAAATC
CCATTCAACTCCAATGGTGCAATTGTCCATGATAAACCCCTCATTTTTGAGTGTGGTCCA
TCCTGTAGGTGCCATTCTTCATGCCACAACAGGGTAAGTCAGAAGGGTATGAAAATCCAC
CTGGAAGTTTTCAGGACAGCCAATAAAGGTTGGGGTGTAAGATCCCTAAGGTCCATCTCT
TCTGGCAGCTTTATATGTGAGTATGTTGGTATCCTGTTGACTGACAAGGAAGCTGACAAG
AGAACAAACGATGAATACTTGTTTGATATAAGCCATAATTGTGATGATGAGGATTGCTCC
AAGGGGAGGCCATCAACTATTTCTAGTCTAAACTCTTCTGGTGGTTGCTCTCAGACCATG
GAAGATGTGTGCTTCACGATAGATGCGTCTGAGTACGGAAATATTGGAAGATTTATCAAC
CATAGTTGCTCACCTAACCTCTATGCACAAAATGTGCTTTGGGATCATGATGACCAAAGG
GTGCCCCATATCATGTTCTTTGCTGCAGAGAACATTCCTCCACTCCAAGAGCTCACTTAT
GACTATAACTATAAAATAGGTGAAGTCCGCGACCTGAATGGCAGAGTAAAAGTTAAAGAT
TGCCATTGTGGTTCTCCACAGTGCTGCGGCAGGCTCTATTAG

CDS

3522 bp

>Os08t0400200-00 Similar to SET domain protein.
ATGGACGGGCCGACGCTGGAACTCTCCGAGATGATGCTCCACGCGGCGCAGCCATGGAGA
AGCCGATGCACGCAGCGTGACGTTCGCCCGGGCGCGGTTCCTCCTCGTCCCGTCGCTGCG
GATGGGCGAGGCGAGGGCACCAGTACAGTGCGAGGGCGCGTGCTGGAGGGGACGACTCGT
GGTGGAGGCAGAGGAGGTGGAATGGAGCGTGAGCGCGAGGTGGTGGCGCCGGCGAGAAAT
GCGGTGGCCGTCGCCGGTGATTTGGCCACGCACGGCGGCGAGCGGGTTGCTGGCCCCTTG
GTGGCGAAGGAGAAGAGAAATGGCGGCGGTGAGTTGGGGACGAAGAGGGGGCTAGAGAAG
CGGGCCCCGCTTCCGCCGCCCAAGCGCAGGGTGGTGTCCGCTAAGCGCCAGTTTCCACCA
GATTTCGGTAGGGACTCTGCTGTTCCACTCGGCCGCGGCCGGGGCCGTGGTGGTGGTGTT
CGTCCGTCGGATGGGGCGCCTGCCCGTGCTGTTCTGGGTGAGAAGGTGGCGTCTGCGGGT
AATGGTGATTCAATGGCGAATGTGCATCATCATGCTGTGATGGACACGGTCTTGATGAAA
TCTTCACATGCTTCGGATGAGAATCTGGTTGCTTTCAAAGTTGGTTCACCAGAGAATGGT
GCAGAAGGGGCAGCAAGGGGAAAGGGAGCACACAATGGTGAATTGCTGGGAAAGAGGGAA
GTGTTGGCTCAAGCTGTGAATTTGCTTCCCATGAGGAGGACTGTATCTGCGACGCACCGC
TTCACTGCTGGGTGTGGGAGGGACGCTGCAGCTCCACTTGCTCGCAGAGAAGAGGGTAAG
GTGGGTTCAGGTTTGGAAGTCATGCCTGTTGATGTTGGTGGGGGTGTGTCAAAGGAGGTG
ATGGCTACGGATGGCAGTAAACATTCGGTTAACCAGTGTACGGCGAACATTGTTGGAGCT
GTCGGTGTTTTGGATGGAACAGTACAGTACCAGGAATTGGAGGAGGGTGAGGTGGCTGAT
GAGGCATACTGTGATGTAGAGTCACAAAAAGTTGTTGGTTGTGATTCTTTTGATGATTCT
GCAGGTGAAAGACATGAGGGTGTTGTTCCTGTAACGTTTGCTGTTACTGAAGTTTTGACA
AGTCACGCTTATGATGAGATGATGCAAATTAAGGCATTGCAAGAAGGGGGCAGTGATGCT
GCGCAGGAAACTGAACATGACTTGCCAATGGGAGGCAAATGTGAAACTATCTTACCTGAT
GCTTCTCCTAAATGTTCGTTTGGTGGTCCTTCAAATGAAATTGTCCACGGCAAGAGAGTG
TTGGGGAGTCATGGCATGAAAGGGGAAGTTCCCAGTCTTGCAATTGAAGATCATGGTGGC
ATTGCTCAAATTGACCAAGAACTGGAGGACGTTGAGATGACTACAGGGGAATACCGTGTT
CAGGATGCTCAAATTGCCACCCATGTTATCCCACACGAGTCTACAACTGGTAGACATGAG
GGGGGGCTTTGTGCATCTGCAGCTGCTGAAGATGTTAAGGTGATGAACAAATACAAAGGG
ACCTTACCCAAAGGTGCTGCTAAATCATCGATGAATATTGCAACAGGAGTATTTGGTGAT
GGTATCATGAGAAGTAAGATACTATCAACAGCTAGAAAAGTAGTCAAGCCACCTGTCAGA
GCAAGCCATAAGCCTCCATTGAACACTCTGCATAGACCCTTCTCCACAAATAGTGCTTCA
TTTGGTCATAAGAAGTTGAAGGTAAAACGTCCAGATCAAAGTAAAGATATTCCTATGAAG
ATTGCCTCTACATCTGGATTGGCGGGCAAGGACAACCTTATCGATGAAAAGGCTTTGAGC
TTGGAAGATGATGATATTTTGAAGGCACTAGTTGTTCATGATGGAAAGCTTGAGGTGTAT
CTCAATGTTCCCTCATGCGTTCAGCTTCATAGGCAACATGGAAGTGGGAATGCTGATGAT
AGGAGCAAAATCAGGATGTTGTGCAGGAGGTTTCAGTTTATATGCAGGGCTCTCTTACAT
GCCGTCGAACAGGGTTCATTGAAGATTCGAAGAGTTGACCTTGCAGCTGATAAAATCATC
AGGAAATTGCCAGGCTTTACCAAACCTGGACCTACTGTGGGAAATGTTAATGGAGTGGAA
GTTGGTGACGAATTTATGTACAGAGTTGAGCTAGCCCTTGTTGGTCTCCATCGCCCATAC
CAGGGAGGAATTGATACCACCGATTATAATGGAGTGCTTGTTGCAATAAGCATCGTTTGT
TCTGGAGGTTATCCTGATGAATTGTCAAGCTCAGGTGAACTAATATACACTGGTTCTGGA
GGAAAGCCTGCTGGTAAGAAGAAAGATGAGGATCAAAAGCTAGAGAGGGGGAACCTTGCC
TTGAAGAATTGCATCGAGACAAAGACACCTGTCCGAGTGATTCATGGATTCAAAGGTCAA
AATAGAGAGGACAACAGTCATTCAAGAGCTAAACAAATCCTAACATTTACTTATGATGGG
TTGTACCTTGTGGTGGATTGCTGGACAGAAGGACTAAAAGGTTCAAGGATCTTCAAATAC
AAATTACAAAGGATTCCTGGACAACCAGAACTTCCTCTGCACATAGCTAAAGGGCTGAGA
AGGTCTCTTTCACGTCCAGGCCTCTGCATAGCTGATATATCTCAAGGGAAAGAAATGGAT
CCCATCTGTGTGATCAATGATGTTAGTAATGTCCATCCAACATCTTTTCAGTACATCTCT
AGAATCAAGTACCCGTCATGGCTTACAAAAAGACATCCTCAGCATCATGGTTGCGATTGC
TCAGATGGCTGCATAGATTCTACTAAGTGCTTTTGTGCTGTGAAGAATGGAGGAAAAATC
CCATTCAACTCCAATGGTGCAATTGTCCATGATAAACCCCTCATTTTTGAGTGTGGTCCA
TCCTGTAGGTGCCATTCTTCATGCCACAACAGGGTAAGTCAGAAGGGTATGAAAATCCAC
CTGGAAGTTTTCAGGACAGCCAATAAAGGTTGGGGTGTAAGATCCCTAAGGTCCATCTCT
TCTGGCAGCTTTATATGTGAGTATGTTGGTATCCTGTTGACTGACAAGGAAGCTGACAAG
AGAACAAACGATGAATACTTGTTTGATATAAGCCATAATTGTGATGATGAGGATTGCTCC
AAGGGGAGGCCATCAACTATTTCTAGTCTAAACTCTTCTGGTGGTTGCTCTCAGACCATG
GAAGATGTGTGCTTCACGATAGATGCGTCTGAGTACGGAAATATTGGAAGATTTATCAAC
CATAGTTGCTCACCTAACCTCTATGCACAAAATGTGCTTTGGGATCATGATGACCAAAGG
GTGCCCCATATCATGTTCTTTGCTGCAGAGAACATTCCTCCACTCCAAGAGCTCACTTAT
GACTATAACTATAAAATAGGTGAAGTCCGCGACCTGAATGGCAGAGTAAAAGTTAAAGAT
TGCCATTGTGGTTCTCCACAGTGCTGCGGCAGGCTCTATTAG

Protein

1174 aa

>Os08t0400200-00 Similar to SET domain protein.
MDGPTLELSEMMLHAAQPWRSRCTQRDVRPGAVPPRPVAADGRGEGTSTVRGRVLEGTTR
GGGRGGGMEREREVVAPARNAVAVAGDLATHGGERVAGPLVAKEKRNGGGELGTKRGLEK
RAPLPPPKRRVVSAKRQFPPDFGRDSAVPLGRGRGRGGGVRPSDGAPARAVLGEKVASAG
NGDSMANVHHHAVMDTVLMKSSHASDENLVAFKVGSPENGAEGAARGKGAHNGELLGKRE
VLAQAVNLLPMRRTVSATHRFTAGCGRDAAAPLARREEGKVGSGLEVMPVDVGGGVSKEV
MATDGSKHSVNQCTANIVGAVGVLDGTVQYQELEEGEVADEAYCDVESQKVVGCDSFDDS
AGERHEGVVPVTFAVTEVLTSHAYDEMMQIKALQEGGSDAAQETEHDLPMGGKCETILPD
ASPKCSFGGPSNEIVHGKRVLGSHGMKGEVPSLAIEDHGGIAQIDQELEDVEMTTGEYRV
QDAQIATHVIPHESTTGRHEGGLCASAAAEDVKVMNKYKGTLPKGAAKSSMNIATGVFGD
GIMRSKILSTARKVVKPPVRASHKPPLNTLHRPFSTNSASFGHKKLKVKRPDQSKDIPMK
IASTSGLAGKDNLIDEKALSLEDDDILKALVVHDGKLEVYLNVPSCVQLHRQHGSGNADD
RSKIRMLCRRFQFICRALLHAVEQGSLKIRRVDLAADKIIRKLPGFTKPGPTVGNVNGVE
VGDEFMYRVELALVGLHRPYQGGIDTTDYNGVLVAISIVCSGGYPDELSSSGELIYTGSG
GKPAGKKKDEDQKLERGNLALKNCIETKTPVRVIHGFKGQNREDNSHSRAKQILTFTYDG
LYLVVDCWTEGLKGSRIFKYKLQRIPGQPELPLHIAKGLRRSLSRPGLCIADISQGKEMD
PICVINDVSNVHPTSFQYISRIKYPSWLTKRHPQHHGCDCSDGCIDSTKCFCAVKNGGKI
PFNSNGAIVHDKPLIFECGPSCRCHSSCHNRVSQKGMKIHLEVFRTANKGWGVRSLRSIS
SGSFICEYVGILLTDKEADKRTNDEYLFDISHNCDDEDCSKGRPSTISSLNSSGGCSQTM
EDVCFTIDASEYGNIGRFINHSCSPNLYAQNVLWDHDDQRVPHIMFFAAENIPPLQELTY
DYNYKIGEVRDLNGRVKVKDCHCGSPQCCGRLY*

CDS

chr08:19085976..19089497 (+ strand) : 3522 bp

FASTA

>Os08t0400200-00 class=Sequence position=chr08:19085976..19089497 (+ strand)
ATGGACGGGC CGACGCTGGA ACTCTCCGAG ATGATGCTCC ACGCGGCGCA GCCATGGAGA AGCCGATGCA CGCAGCGTGA
CGTTCGCCCG GGCGCGGTTC CTCCTCGTCC CGTCGCTGCG GATGGGCGAG GCGAGGGCAC CAGTACAGTG CGAGGGCGCG
TGCTGGAGGG GACGACTCGT GGTGGAGGCA GAGGAGGTGG AATGGAGCGT GAGCGCGAGG TGGTGGCGCC GGCGAGAAAT
GCGGTGGCCG TCGCCGGTGA TTTGGCCACG CACGGCGGCG AGCGGGTTGC TGGCCCCTTG GTGGCGAAGG AGAAGAGAAA
TGGCGGCGGT GAGTTGGGGA CGAAGAGGGG GCTAGAGAAG CGGGCCCCGC TTCCGCCGCC CAAGCGCAGG GTGGTGTCCG
CTAAGCGCCA GTTTCCACCA GATTTCGGTA GGGACTCTGC TGTTCCACTC GGCCGCGGCC GGGGCCGTGG TGGTGGTGTT
CGTCCGTCGG ATGGGGCGCC TGCCCGTGCT GTTCTGGGTG AGAAGGTGGC GTCTGCGGGT AATGGTGATT CAATGGCGAA
TGTGCATCAT CATGCTGTGA TGGACACGGT CTTGATGAAA TCTTCACATG CTTCGGATGA GAATCTGGTT GCTTTCAAAG
TTGGTTCACC AGAGAATGGT GCAGAAGGGG CAGCAAGGGG AAAGGGAGCA CACAATGGTG AATTGCTGGG AAAGAGGGAA
GTGTTGGCTC AAGCTGTGAA TTTGCTTCCC ATGAGGAGGA CTGTATCTGC GACGCACCGC TTCACTGCTG GGTGTGGGAG
GGACGCTGCA GCTCCACTTG CTCGCAGAGA AGAGGGTAAG GTGGGTTCAG GTTTGGAAGT CATGCCTGTT GATGTTGGTG
GGGGTGTGTC AAAGGAGGTG ATGGCTACGG ATGGCAGTAA ACATTCGGTT AACCAGTGTA CGGCGAACAT TGTTGGAGCT
GTCGGTGTTT TGGATGGAAC AGTACAGTAC CAGGAATTGG AGGAGGGTGA GGTGGCTGAT GAGGCATACT GTGATGTAGA
GTCACAAAAA GTTGTTGGTT GTGATTCTTT TGATGATTCT GCAGGTGAAA GACATGAGGG TGTTGTTCCT GTAACGTTTG
CTGTTACTGA AGTTTTGACA AGTCACGCTT ATGATGAGAT GATGCAAATT AAGGCATTGC AAGAAGGGGG CAGTGATGCT
GCGCAGGAAA CTGAACATGA CTTGCCAATG GGAGGCAAAT GTGAAACTAT CTTACCTGAT GCTTCTCCTA AATGTTCGTT
TGGTGGTCCT TCAAATGAAA TTGTCCACGG CAAGAGAGTG TTGGGGAGTC ATGGCATGAA AGGGGAAGTT CCCAGTCTTG
CAATTGAAGA TCATGGTGGC ATTGCTCAAA TTGACCAAGA ACTGGAGGAC GTTGAGATGA CTACAGGGGA ATACCGTGTT
CAGGATGCTC AAATTGCCAC CCATGTTATC CCACACGAGT CTACAACTGG TAGACATGAG GGGGGGCTTT GTGCATCTGC
AGCTGCTGAA GATGTTAAGG TGATGAACAA ATACAAAGGG ACCTTACCCA AAGGTGCTGC TAAATCATCG ATGAATATTG
CAACAGGAGT ATTTGGTGAT GGTATCATGA GAAGTAAGAT ACTATCAACA GCTAGAAAAG TAGTCAAGCC ACCTGTCAGA
GCAAGCCATA AGCCTCCATT GAACACTCTG CATAGACCCT TCTCCACAAA TAGTGCTTCA TTTGGTCATA AGAAGTTGAA
GGTAAAACGT CCAGATCAAA GTAAAGATAT TCCTATGAAG ATTGCCTCTA CATCTGGATT GGCGGGCAAG GACAACCTTA
TCGATGAAAA GGCTTTGAGC TTGGAAGATG ATGATATTTT GAAGGCACTA GTTGTTCATG ATGGAAAGCT TGAGGTGTAT
CTCAATGTTC CCTCATGCGT TCAGCTTCAT AGGCAACATG GAAGTGGGAA TGCTGATGAT AGGAGCAAAA TCAGGATGTT
GTGCAGGAGG TTTCAGTTTA TATGCAGGGC TCTCTTACAT GCCGTCGAAC AGGGTTCATT GAAGATTCGA AGAGTTGACC
TTGCAGCTGA TAAAATCATC AGGAAATTGC CAGGCTTTAC CAAACCTGGA CCTACTGTGG GAAATGTTAA TGGAGTGGAA
GTTGGTGACG AATTTATGTA CAGAGTTGAG CTAGCCCTTG TTGGTCTCCA TCGCCCATAC CAGGGAGGAA TTGATACCAC
CGATTATAAT GGAGTGCTTG TTGCAATAAG CATCGTTTGT TCTGGAGGTT ATCCTGATGA ATTGTCAAGC TCAGGTGAAC
TAATATACAC TGGTTCTGGA GGAAAGCCTG CTGGTAAGAA GAAAGATGAG GATCAAAAGC TAGAGAGGGG GAACCTTGCC
TTGAAGAATT GCATCGAGAC AAAGACACCT GTCCGAGTGA TTCATGGATT CAAAGGTCAA AATAGAGAGG ACAACAGTCA
TTCAAGAGCT AAACAAATCC TAACATTTAC TTATGATGGG TTGTACCTTG TGGTGGATTG CTGGACAGAA GGACTAAAAG
GTTCAAGGAT CTTCAAATAC AAATTACAAA GGATTCCTGG ACAACCAGAA CTTCCTCTGC ACATAGCTAA AGGGCTGAGA
AGGTCTCTTT CACGTCCAGG CCTCTGCATA GCTGATATAT CTCAAGGGAA AGAAATGGAT CCCATCTGTG TGATCAATGA
TGTTAGTAAT GTCCATCCAA CATCTTTTCA GTACATCTCT AGAATCAAGT ACCCGTCATG GCTTACAAAA AGACATCCTC
AGCATCATGG TTGCGATTGC TCAGATGGCT GCATAGATTC TACTAAGTGC TTTTGTGCTG TGAAGAATGG AGGAAAAATC
CCATTCAACT CCAATGGTGC AATTGTCCAT GATAAACCCC TCATTTTTGA GTGTGGTCCA TCCTGTAGGT GCCATTCTTC
ATGCCACAAC AGGGTAAGTC AGAAGGGTAT GAAAATCCAC CTGGAAGTTT TCAGGACAGC CAATAAAGGT TGGGGTGTAA
GATCCCTAAG GTCCATCTCT TCTGGCAGCT TTATATGTGA GTATGTTGGT ATCCTGTTGA CTGACAAGGA AGCTGACAAG
AGAACAAACG ATGAATACTT GTTTGATATA AGCCATAATT GTGATGATGA GGATTGCTCC AAGGGGAGGC CATCAACTAT
TTCTAGTCTA AACTCTTCTG GTGGTTGCTC TCAGACCATG GAAGATGTGT GCTTCACGAT AGATGCGTCT GAGTACGGAA
ATATTGGAAG ATTTATCAAC CATAGTTGCT CACCTAACCT CTATGCACAA AATGTGCTTT GGGATCATGA TGACCAAAGG
GTGCCCCATA TCATGTTCTT TGCTGCAGAG AACATTCCTC CACTCCAAGA GCTCACTTAT GACTATAACT ATAAAATAGG
TGAAGTCCGC GACCTGAATG GCAGAGTAAA AGTTAAAGAT TGCCATTGTG GTTCTCCACA GTGCTGCGGC AGGCTCTATT
AG