Os08t0465800-01

Locus

Os08g0465800

Description

Similar to Glutamate decarboxylase.

Transcript Evidence

AK121088 (DDBJ, Best hit)

Protein Evidence

B9TST3 (UniProt)

CGSNL Gene Symbol

_

CGSNL Gene Name

_

CGSNL Gene Symbol Synonym(s)

OsGAD1

CGSNL Gene Name Synonym(s)

glutamate decarboxylase 1

Literature (PMID)

Manual Curation

Note

GO

Biological Process: glutamate metabolic process (GO:0006536)

Biological Process: carboxylic acid metabolic process (GO:0019752)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: glutamate decarboxylase activity (GO:0004351)

Molecular Function: carboxy-lyase activity (GO:0016831)

Molecular Function: pyridoxal phosphate binding (GO:0030170)

InterPro

Pyridoxal phosphate-dependent decarboxylase (IPR002129)

Glutamate decarboxylase (IPR010107)

Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (IPR015421)

Pyridoxal phosphate-dependent transferase, major domain (IPR015424)

KEGG

Os08t0465800-01 (EC:4.1.1.15)

KOME

J023065G12 (Online Clone Ordering)

RiceXPro Database

AK121088

Oryzabase

14091

Plant Gene Family Database (PGFD)

Os08t0465800-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os08t0465800-01

Transcript

1975 bp

>Os08t0465800-01 Similar to Glutamate decarboxylase.
GCGGTTAGTACTTAGCACCACCACCACCACGTCGTTTCATCTCAGCAGACATCAGTTGTT
GTCACTTCTAATCTTCCACTATTAGTAGTACGGTTGCCACACTGCTAGCCAATCCACTTC
GATTGGTTCCACCGCGCCTACCGAGTTTCCCTTGCTAGGCAGTAGAGAGAGTCTGTGATC
GAGAGAGAAGAGGATCGAGCAGCTAGCAAGCCGGCGGGCGCCATGGTGCTCTCGCACGCG
AGCTCCGGCCGGGACGACGCCGTGCGCTGCACCTTCGCGACGCGCTACGCCTGCGAGACG
CTGCCGCGGTTCAGGATGCCGGAGCAGTCGATCCCGAGGGAGGCGGCGTACCAGATCATC
AACGACGAGCTGATGCTGGACGGGAACCCGCGGCTGAACCTGGCGTCCTTCGTCACCACG
TGGATGGAGCCCGAGTGCGACAAGCTCATCATGGACTCCGTTAACAAGAACTACGTCGAC
ATGGACGAGTACCCTGTCACCACGGAGCTCCAGAACCGTTGTGTGAATATGATAGCTCAC
CTGTTCAATGCACCAATCAAGGAGGATGAAACAGCTATTGGAGTTGGGACGGTGGGATCC
TCAGAAGCAATTATGCTTGCAGGACTGGCATTCAAGAGGAAGTGGCAAAACAAACGGAAG
GAACAGGGGAAGCCATGTGACAAACCCAACATTGTTACTGGTGCTAATGTTCAGGTTTGC
TGGGAGAAATTTGCCAGATATTTTGAAGTAGAACTGAAGGAGGTTAAGCTCAGTGAAGGA
TACTATGTCATGGATCCTGTAAAGGCTGTTGAAATGGTGGATGAGAACACTATATGCGTT
GCGGCCATCTTGGGCTCTACTCTCACTGGAGAGTTTGAGGATGTTAAGTTATTGAATAAT
CTCCTAACAGAAAAGAATAAGGAAACTGGGTGGGATGTGCCAATTCATGTTGATGCAGCA
AGTGGAGGATTTATAGCACCTTTTCTATACCCTGAGCTTGAATGGGACTTCAGGCTACCA
CTGGTGAAGAGCATCAATGTCAGTGGGCACAAGTATGGCCTTGTGTATCCAGGTGTTGGT
TGGGTCATTTGGCGAAGCAAAGAGGATTTGCCTGAAGAACTCATTTTCCATATAAACTAT
CTGGGGACAGACCAGCCGACGTTCACTCTGAACTTCTCCAAAGGTTCCAGCCAGATAATC
GCACAGTACTATCAACTAATACGCCTGGGATTCGAGGGATACAAGAACATCATGCAGAAT
TGCATGGAGAACACAGCAATACTAAGGGAAGGCATAGAGGCGACTGGTCGATTCGAAATC
CTCTCCAAGGAGGCCGGTGTGCCCTTGGTGGCGTTCTCGCTCAAGGACAGCGGCAGGTAC
ACCGTGTTCGACATCTCCGAGCACCTGAGGAGGTTCGGCTGGATCGTGCCGGCGTACACC
ATGCCGGCCAACGCCGAGCACGTCGCCGTCCTCCGCGTCGTCATCAGGGAGGACTTCAGC
CGGAGCCTCGCCGAGCGGCTCGTCTCGGACATCGTCAAGATCCTGCACGAGCTGGACGCC
CATTCGGCCCAGGTGCTGAAGATCTCCAGCGCCATCGCGAAGCAGCAATCGGGCGACGAT
GGCGTGGTCACCAAGAAGAGCGTCCTGGAGACCGAGAGGGAGATCTTCGCGTACTGGAGG
GACCAGGTGAAGAAGAAGCAGACCGGAATCTGCTAGTGTGGCTCTGTGAGAAATGCTTGA
ATAACGTGGCATGCTCGATTTGTGCATGGGATGGCCGGATCGGATGGGACTGACTGGCGG
TGTACGGACATGGCTGCCCTTGTTCTTATGTTGAACTGTTGATGTAGAAAAATGTGTGGC
CTTTGTATGGTTGTAAGCCATCTACGTACCATGGACTTCAGCTATTTGGTGGTTTGTTTT
CAACTTTTCCATGTACACCTGGGGCTTGCCAATCTCCTTCCTCCTCTTTTTAATC

CDS

1494 bp

>Os08t0465800-01 Similar to Glutamate decarboxylase.
ATGGTGCTCTCGCACGCGAGCTCCGGCCGGGACGACGCCGTGCGCTGCACCTTCGCGACG
CGCTACGCCTGCGAGACGCTGCCGCGGTTCAGGATGCCGGAGCAGTCGATCCCGAGGGAG
GCGGCGTACCAGATCATCAACGACGAGCTGATGCTGGACGGGAACCCGCGGCTGAACCTG
GCGTCCTTCGTCACCACGTGGATGGAGCCCGAGTGCGACAAGCTCATCATGGACTCCGTT
AACAAGAACTACGTCGACATGGACGAGTACCCTGTCACCACGGAGCTCCAGAACCGTTGT
GTGAATATGATAGCTCACCTGTTCAATGCACCAATCAAGGAGGATGAAACAGCTATTGGA
GTTGGGACGGTGGGATCCTCAGAAGCAATTATGCTTGCAGGACTGGCATTCAAGAGGAAG
TGGCAAAACAAACGGAAGGAACAGGGGAAGCCATGTGACAAACCCAACATTGTTACTGGT
GCTAATGTTCAGGTTTGCTGGGAGAAATTTGCCAGATATTTTGAAGTAGAACTGAAGGAG
GTTAAGCTCAGTGAAGGATACTATGTCATGGATCCTGTAAAGGCTGTTGAAATGGTGGAT
GAGAACACTATATGCGTTGCGGCCATCTTGGGCTCTACTCTCACTGGAGAGTTTGAGGAT
GTTAAGTTATTGAATAATCTCCTAACAGAAAAGAATAAGGAAACTGGGTGGGATGTGCCA
ATTCATGTTGATGCAGCAAGTGGAGGATTTATAGCACCTTTTCTATACCCTGAGCTTGAA
TGGGACTTCAGGCTACCACTGGTGAAGAGCATCAATGTCAGTGGGCACAAGTATGGCCTT
GTGTATCCAGGTGTTGGTTGGGTCATTTGGCGAAGCAAAGAGGATTTGCCTGAAGAACTC
ATTTTCCATATAAACTATCTGGGGACAGACCAGCCGACGTTCACTCTGAACTTCTCCAAA
GGTTCCAGCCAGATAATCGCACAGTACTATCAACTAATACGCCTGGGATTCGAGGGATAC
AAGAACATCATGCAGAATTGCATGGAGAACACAGCAATACTAAGGGAAGGCATAGAGGCG
ACTGGTCGATTCGAAATCCTCTCCAAGGAGGCCGGTGTGCCCTTGGTGGCGTTCTCGCTC
AAGGACAGCGGCAGGTACACCGTGTTCGACATCTCCGAGCACCTGAGGAGGTTCGGCTGG
ATCGTGCCGGCGTACACCATGCCGGCCAACGCCGAGCACGTCGCCGTCCTCCGCGTCGTC
ATCAGGGAGGACTTCAGCCGGAGCCTCGCCGAGCGGCTCGTCTCGGACATCGTCAAGATC
CTGCACGAGCTGGACGCCCATTCGGCCCAGGTGCTGAAGATCTCCAGCGCCATCGCGAAG
CAGCAATCGGGCGACGATGGCGTGGTCACCAAGAAGAGCGTCCTGGAGACCGAGAGGGAG
ATCTTCGCGTACTGGAGGGACCAGGTGAAGAAGAAGCAGACCGGAATCTGCTAG

Protein

498 aa

>Os08t0465800-01 Similar to Glutamate decarboxylase.
MVLSHASSGRDDAVRCTFATRYACETLPRFRMPEQSIPREAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDSVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIKEDETAIG
VGTVGSSEAIMLAGLAFKRKWQNKRKEQGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNNLLTEKNKETGWDVP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYPGVGWVIWRSKEDLPEEL
IFHINYLGTDQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNIMQNCMENTAILREGIEA
TGRFEILSKEAGVPLVAFSLKDSGRYTVFDISEHLRRFGWIVPAYTMPANAEHVAVLRVV
IREDFSRSLAERLVSDIVKILHELDAHSAQVLKISSAIAKQQSGDDGVVTKKSVLETERE
IFAYWRDQVKKKQTGIC*

5'UTR

chr08:22882509..22882730 (- strand) : 222 bp

CDS

chr08:22882423..22882508 (- strand) : 86 bp

chr08:22882117..22882321 (- strand) : 205 bp

chr08:22880708..22880908 (- strand) : 201 bp

chr08:22880401..22880615 (- strand) : 215 bp

chr08:22879852..22880105 (- strand) : 254 bp

chr08:22879715..22879767 (- strand) : 53 bp

chr08:22878994..22879473 (- strand) : 480 bp

3'UTR

chr08:22878735..22878993 (- strand) : 259 bp

FASTA

>Os08t0465800-01 class=Sequence position=chr08:22878735..22882730 (- strand)
GCGGTTAGTA CTTAGCACCA CCACCACCAC GTCGTTTCAT CTCAGCAGAC ATCAGTTGTT GTCACTTCTA ATCTTCCACT
ATTAGTAGTA CGGTTGCCAC ACTGCTAGCC AATCCACTTC GATTGGTTCC ACCGCGCCTA CCGAGTTTCC CTTGCTAGGC
AGTAGAGAGA GTCTGTGATC GAGAGAGAAG AGGATCGAGC AGCTAGCAAG CCGGCGGGCG CCATGGTGCT CTCGCACGCG
AGCTCCGGCC GGGACGACGC CGTGCGCTGC ACCTTCGCGA CGCGCTACGC CTGCGAGACG CTGCCGCGGT GCTGGCTGCA
TGCTCCGATC TCTCGGTTGG GTTTTGGCCA ATTTGGGCGC CGCGCGGGGC TGTGCTGATC GATCGATTGC TTCGTTGTTG
AGTGTGCAGG TTCAGGATGC CGGAGCAGTC GATCCCGAGG GAGGCGGCGT ACCAGATCAT CAACGACGAG CTGATGCTGG
ACGGGAACCC GCGGCTGAAC CTGGCGTCCT TCGTCACCAC GTGGATGGAG CCCGAGTGCG ACAAGCTCAT CATGGACTCC
GTTAACAAGA ACTACGTCGA CATGGACGAG TACCCTGTCA CCACGGAGCT CCAGGTCGGA ATTAAACCAC ATGGGATCTT
TCTTCTATTT TGTTctccgg gctgataata cttgcccttt tggacaaggg tgaagtcaaa ctttagaatc tttgattata
aatcattttt aaaatatttg tcttttaaat atggtgacta ttatggtgac tatatgtata gattagtctt aaaaattatt
ttaataagat catatatttg ctaacaattt tatacatatt ataataaaaa ataatagtta aagttgtttt ttttggagac
cgtgcccttg tccaaaacga caagtattat caacccggag ggagAACATA TATATGGGGG GAATCCTGTT TCAACACAAG
TAATGTTACG TACTCCCGTT GTGAGATTTG CTTTGAGATT CGCGCACCAG CATAGTTGAT TGAATTCCTC TGTTTAGTTC
AGCTCTAGTC TTAAGGAATA ATTAATTTTG TGGAACTAAT TAGTACAGCT CTAGTACTCC ACTTCGCAAG GATGGAAGGA
TAAGGATCCT AACACCTGTT ATTTGGGCAG TTGATAGCTG ATCATAATTA GGTTATGGAC AAGTTATGAC ACATCATACT
TTTTGATGTG ATTGGACTTT TCTGGGTCCA TAACCAACAA TCCTGGACAG TTTTCAGCTT GTTGCTGATC ACAACATTTT
TACTGAATAT GTTCTAGAAA GAACATTTTT GTTTACTGAA TGTAGAAAAG GGGAAGTTTT ACCATTCACC TTGTATTCAA
AATGACTCCA ACCATGCCAG CAGGGAATTG GAAATTCAGA TTCATCTTTA TGGAACTGCC ATTTGATGTT AGAGAGTACT
GCTACATACG GATAACAATG GCATTTTATC AAACCTTTGT TTTGTGAGAT TTTTTTTTTG CTGTTCTTAA AGGGAAAGGG
AGATACTAAG AGGTATCACA TTTTTTGCTG TAATTTCTTT TTAAGTTGAA ACTGAAACCA CATTCAAATA AAGTTCTACT
GCTCTCTTCT CACTGTACAT TTGTATTATT TGGAAAGTTA ACTTACTGGC TATTTATTGA TTTTTACCAG GGCTTTTTTT
TATCATGTTT CAGCTTTTTT TGTTAACACA CAGTCTTGAT TTAGTCATTT TTTAGTCAAG CTAATGACAT ATTCATTCAG
AAAAAAAGAA TAATAGCTAC ATCTAACTAT TGTTTGCTGA CTACTTGCAT GTACTTTTGC AGAACCGTTG TGTGAATATG
ATAGCTCACC TGTTCAATGC ACCAATCAAG GAGGATGAAA CAGCTATTGG AGTTGGGACG GTGGGATCCT CAGAAGCAAT
TATGCTTGCA GGACTGGCAT TCAAGAGGAA GTGGCAAAAC AAACGGAAGG AACAGGGGAA GCCATGTGAC AAACCCAACA
TTGTTACTGG TGCTAATGTT CAGGTATTTT TGTTTCATTG TCATGTGAAG TGTTTTTATC TTAGCCATTA TAGTTATCTA
AGAAAAAGGC CTGTGGTGAT TCCCCGTGTT CCTAGGTTTG CTGGGAGAAA TTTGCCAGAT ATTTTGAAGT AGAACTGAAG
GAGGTTAAGC TCAGTGAAGG ATACTATGTC ATGGATCCTG TAAAGGCTGT TGAAATGGTG GATGAGAACA CTATATGCGT
TGCGGCCATC TTGGGCTCTA CTCTCACTGG AGAGTTTGAG GATGTTAAGT TATTGAATAA TCTCCTAACA GAAAAGAATA
AGGAAACTGG GTATGCATTT TATCTGTTCT TTAGTCAATC AACTATCTGC GCAATGCAAC AGCTAGCAAT ATGCATGCTT
TAGGTTGTCT CTGGAGGTCG ATCGGTATGA CCAGGAAAAC TGGTAACCTG TTGTGACCAG ATTACTTAAC TATTCTTTTG
TCAATCCCTC ATTACTTGTT TTTATGCTCA GCTGTGTGTG CCAAAAGAAA ACAAAAATGT ATACAAATTT TTTATTTGCA
ACTCATCTTA CATAAATTGG CCACACTTCT TGCAAGGTAG TTAATCTGTT ACACAAAACA TGCAGGTGGG ATGTGCCAAT
TCATGTTGAT GCAGCAAGTG GAGGATTTAT AGCACCTTTT CTATACCCTG AGCTTGAATG GGACTTCAGG CTACCACTGG
TGAAGAGCAT CAATGTCAGT GGGCACAAGT ATGGCCTTGT GTATCCAGGT GTTGGTTGGG TCATTTGGCG AAGCAAAGAG
GATTTGCCTG AAGAACTCAT TTTCCATATA AACTATCTGG GGACAGACCA GCCGACGTTC ACTCTGAACT TCTCCAAAGG
TACATACATT TTCTTGTAGT TTCATCACCA AACTTTAATT CTTTTGTATT TCAACAAACC AAGTTCAAGG CAATATTGTG
TAGGTTCCAG CCAGATAATC GCACAGTACT ATCAACTAAT ACGCCTGGGA TTCGAGGTAC TTTACTTTTC TTCATATCCC
TCATGGAAAC TGCAGAACAT TTTCTTTGCC GAGCCGGCGG CAAGGACCCG CTGCCAGTTT ATTAAGATTG GGACAGGTTT
TTGACAAGAA CAACAAACAT GGTTGTTGTG ACTTCAGAAA CCAGATAGTA TCCACGCAGG CGCTCATATA AACGCTCTTC
CTCACATAAA AAAGAGAGTT TCTGGCCATT TAGAACTATT TTGGTTTCTT TCTGCAGGGA TACAAGAACA TCATGCAGAA
TTGCATGGAG AACACAGCAA TACTAAGGGA AGGCATAGAG GCGACTGGTC GATTCGAAAT CCTCTCCAAG GAGGCCGGTG
TGCCCTTGGT GGCGTTCTCG CTCAAGGACA GCGGCAGGTA CACCGTGTTC GACATCTCCG AGCACCTGAG GAGGTTCGGC
TGGATCGTGC CGGCGTACAC CATGCCGGCC AACGCCGAGC ACGTCGCCGT CCTCCGCGTC GTCATCAGGG AGGACTTCAG
CCGGAGCCTC GCCGAGCGGC TCGTCTCGGA CATCGTCAAG ATCCTGCACG AGCTGGACGC CCATTCGGCC CAGGTGCTGA
AGATCTCCAG CGCCATCGCG AAGCAGCAAT CGGGCGACGA TGGCGTGGTC ACCAAGAAGA GCGTCCTGGA GACCGAGAGG
GAGATCTTCG CGTACTGGAG GGACCAGGTG AAGAAGAAGC AGACCGGAAT CTGCTAGTGT GGCTCTGTGA GAAATGCTTG
AATAACGTGG CATGCTCGAT TTGTGCATGG GATGGCCGGA TCGGATGGGA CTGACTGGCG GTGTACGGAC ATGGCTGCCC
TTGTTCTTAT GTTGAACTGT TGATGTAGAA AAATGTGTGG CCTTTGTATG GTTGTAAGCC ATCTACGTAC CATGGACTTC
AGCTATTTGG TGGTTTGTTT TCAACTTTTC CATGTACACC TGGGGCTTGC CAATCTCCTT CCTCCTCTTT TTAATC