Os09t0315700-01

Locus

Os09g0315700

Description

Phosphoenolpyruvate carboxylase family protein.

Transcript Evidence

AK240668 (DDBJ, Best hit)

AK242583 (DDBJ, Best hit)

Protein Evidence

P29194 (UniProt)

CGSNL Gene Symbol

CGSNL Gene Name

CGSNL Gene Symbol Synonym(s)

CGSNL Gene Name Synonym(s)

Literature (PMID)

Manual Curation

Note

GO

Biological Process: tricarboxylic acid cycle (GO:0006099)

Biological Process: carbon fixation (GO:0015977)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: phosphoenolpyruvate carboxylase activity (GO:0008964)

InterPro

Pyruvate/Phosphoenolpyruvate kinase (IPR015813)

Phosphoenolpyruvate carboxylase, active site (IPR018129)

Phosphoenolpyruvate carboxylase (IPR021135)

Phosphoenolpyruvate carboxylase, bacterial/plant-type (IPR022805)

KEGG

Os09t0315700-01 (EC:4.1.1.31)

KOME

J033066E20 (Online Clone Ordering)

J090010K11 (Online Clone Ordering)

Plant Gene Family Database (PGFD)

Os09t0315700-01

Transcript

3170 bp

>Os09t0315700-01 Phosphoenolpyruvate carboxylase family protein.
ACCAAGTTCGCAGCAGCAATCGTCTTCCTCTTCTTCTTGTTGTTGTTGGCGATGTCGGCG
ATGTCGGCGGCGGGCGGCGGCGGCGGCGTGGGGAAGGTGGAGCGGCTGTCGTCGATCGAC
GCGCAGCTGCGGCAGCTGGTGCCGGCGAAGCTGTCGGAGGACGACAAGCTCATCGAGTAC
GACGCGCTCCTCCTCGACCGATTCCTCGACGTCCTCCATGGCCTCCACGGCGACGACCTC
AAGGATCTCGTTCAAGAATGCTATGAGGTGGCCGCGGAGTATGAAACAAAGCACGACGTG
CAAAAGCTCGATGAACTCGGCAACATGATAACAAGCTTGGATCCGGGCGACTCGATTGTT
ATTGCGAAAGCCTTTTCGCACATGCTTAACTTGGCCAACTTGGCTGAAGAAGTCCAGATC
GCATACAGGAGGAGGATCAAGCTCAAGAAGGGTGATTTCGCTGACGAAAACTCGGCAATG
ACTGAATCCGACATTGAGGAAACACTCAAGAGGCTTGTTTTTGACCTGAAGAAATCCCCT
GCTGAGGTCTTTGATGCCCTCAAGAGTCAGACTGTTGACCTTGTTTTGACTGCACATCCA
ACACAGTCTGTGAGGAGGTCACTGCTCCAGAAACACTCCAGGATTCGGAACTGTCTGGTT
CAGCTTTATTCAAAGGATATCACTCCAGATGACAAGCAAGAGCTTGATGAGGCTCTCCAG
AGAGAGATCCAAGCTGCCTTTAGAACCGATGAGATCCGAAGAACACAGCCCACTCCCCAA
GATGAAATGCGTGCTGGCATGAGCTACTTCCATGAAACAATATGGAAGGGTGTTCCAAAG
TTCTTGCGCCGTGTGGATACTGCATTGAAGAACATCGGTATCGACGAGCGTGTTCCTTAC
AATGCTCCTCTTATTCAGTTCTCGTCTTGGATGGGAGGAGATCGTGATGGAAATCCAAGA
GTCACACCAGAGGTTACAAGGGATGTCTGCTTGCTTGCAAGAATGATGGCAGCAAACTTG
TATTGCTCACAAATTGAGGATCTCATGTTTGAGTTATCTATGTGGCGATGTAACGAGGAG
CTACGCTCACGAGCTGATGATCTGCACCGCTCTTCTAAGAAGGACGCAAAGCATTACATA
GAGTTTTGGAAGAAGGTTCCTCTGAATGAACCATACCGGGTGATACTGAGTGATGTGAGA
GATAAGCTTTACAATACACGTGAACGATCACGGGAGTTGTTGTCCAGCGGATATTGCGAC
ATCCCTGAGGAAGCAACTCTGACAAATGTTGAGCAGCTATTGGAGCCCTTGGAGCTATGC
TACAGGTCGCTGTGCGCCTGTGGTGACCGTGCCATCGCTGATGGAAGCCTTCTTGATTTC
TTGCGCCAAGTTTCCACCTTTGGACTCTCCCTTGTGAGGCTTGACATTAGGCAAGAATCC
GACAGACACACCGATGTCCTTGATGCCATCACGACATACCTGGGCATAGGATCTTACCGT
GAGTGGTCCGAGGAACGCCGTCAAGAGTGGCTGTTGTCCGAACTCAACGGGAAGCGACCA
TTGTTTGGCCCAGACCTTCCCAGGACAGATGAGGTTGCTGATGTTCTAGACACATTCCAT
GTGATTGCCGAGCTCCCTGCTGACAGTTTTGGAGCCTATGTTATTTCCATGGCAACAGCC
CCCTCGGATGTCCTTGCTGTTGAGCTCCTCCAACGCGAGTGCCATGTCAAGACACCGCTT
AGAGTTGTCCCCCTGTTCGAGAAGTTGGCTGATCTTGAGTCTGCCCCTGCGGCATTGACC
AGGCTCTTCTCAATAAGTTGGTACAGGCAGAGGATCAATGGTAAGCAGGAGGTCATGATT
GGGTATTCAGATTCAGGCAAGGATGCTGGCCGTCTCTCGGCAGCTTGGCAGATGTACAAG
GCTCAGGAGCAGCTCGTCAAGGTAGCGAAGGATTTCGGGGTCAAGTTGACGATGTTCCAT
GGACGAGGTGGAACCGTTGGTAGGGGCGGTGGGCCGACTCACCTTGCCATCTTGTCTCAG
CCTCCAGACACGATCAACGGATCGCTCCGTGTCACTGTTCAGGGTGAAGTCATTGAGCAG
AGCTTTGGTGAGGAGCACTTGTGTTTCAGGACACTGCAGCGTTTCACCGCTGCTACACTT
GAGCACGGCATGCATCCACCCAGTGCACCGAAGCCAGAATGGCGAGCTCTTCTTGATGAG
ATGGCTGTGGTGGCAACCAAGGAGTATCGATCCGTAGTGTTCCAAGAGCCACGCTTTGTG
GAGTATTTCCGCCTTGCAACACCTGAGACAGAGTATGGAAGGATGAACATAGGAAGCAGG
CCATCCAAGAGGAAGCCGAGTGGAGGCATTGAATCACTCCGTGCGATCCCATGGATCTTC
GCATGGACGCAGACCCGCTTCCACCTTCCCGTCTGGCTTGGATTCGGTGCTGCATTCAAG
CACGCCCTTCAGAAGGACATCAGGAATCTCCACATGCTCCAGGAGATGTACAACGAGTGG
CCGTTCTTCAGGGTCACTCTCGACCTGATTGAGATGGTTTTCGCCAAGGGTAATCCTGGC
ATTGCTGCCCTTTACGACAAACTCCTCGTTTCTGAGGATCTACAGCCACTGGGTGAGAAG
CTGAGAGCCAACTATGTAGAGACACAAAAGCTGCTTCTTCAGGTTGCTGGCCATAGGGAT
CTTCTTGAAGGTGACCCCTACCTGAAGCAGCGGCTCCGACTCCGCGACGCCTACATAACC
ACCCTGAATGTCTGCCAAGCCTACACGCTGAAACGGATCCGCGACCCGGATTACCACGTC
ACGCTGCGCCCTCACCTGTCCAAGGAGGTGATGGATGGGAGCAAGCCGGCCGCGGAGCTT
GTGAAGCTGAACCCGGGTAGCGAGTACGCGCCAGGGCTGGAGGACACCCTCATCCTGACC
ATGAAGGGCATTGCTGCAGGGTTGCAGAACACTGGTTAAGACTTAGGAGAGATTGCCTGA
GTGCCATCTTTTTTGTATCTTTCCTTTGATCATTTGCCTTGGGCCCTGTTATTTTGGATA
CTGCTGAATATTGGTCTCCTTACTGAGGGAGGGGTAACAAATACCGGCGTTTTTTTGCCT
ATGTATATTATTACTGAAATAAAAGGAGACCATGATCATTATAATAACCT

CDS

2928 bp

>Os09t0315700-01 Phosphoenolpyruvate carboxylase family protein.
ATGTCGGCGATGTCGGCGGCGGGCGGCGGCGGCGGCGTGGGGAAGGTGGAGCGGCTGTCG
TCGATCGACGCGCAGCTGCGGCAGCTGGTGCCGGCGAAGCTGTCGGAGGACGACAAGCTC
ATCGAGTACGACGCGCTCCTCCTCGACCGATTCCTCGACGTCCTCCATGGCCTCCACGGC
GACGACCTCAAGGATCTCGTTCAAGAATGCTATGAGGTGGCCGCGGAGTATGAAACAAAG
CACGACGTGCAAAAGCTCGATGAACTCGGCAACATGATAACAAGCTTGGATCCGGGCGAC
TCGATTGTTATTGCGAAAGCCTTTTCGCACATGCTTAACTTGGCCAACTTGGCTGAAGAA
GTCCAGATCGCATACAGGAGGAGGATCAAGCTCAAGAAGGGTGATTTCGCTGACGAAAAC
TCGGCAATGACTGAATCCGACATTGAGGAAACACTCAAGAGGCTTGTTTTTGACCTGAAG
AAATCCCCTGCTGAGGTCTTTGATGCCCTCAAGAGTCAGACTGTTGACCTTGTTTTGACT
GCACATCCAACACAGTCTGTGAGGAGGTCACTGCTCCAGAAACACTCCAGGATTCGGAAC
TGTCTGGTTCAGCTTTATTCAAAGGATATCACTCCAGATGACAAGCAAGAGCTTGATGAG
GCTCTCCAGAGAGAGATCCAAGCTGCCTTTAGAACCGATGAGATCCGAAGAACACAGCCC
ACTCCCCAAGATGAAATGCGTGCTGGCATGAGCTACTTCCATGAAACAATATGGAAGGGT
GTTCCAAAGTTCTTGCGCCGTGTGGATACTGCATTGAAGAACATCGGTATCGACGAGCGT
GTTCCTTACAATGCTCCTCTTATTCAGTTCTCGTCTTGGATGGGAGGAGATCGTGATGGA
AATCCAAGAGTCACACCAGAGGTTACAAGGGATGTCTGCTTGCTTGCAAGAATGATGGCA
GCAAACTTGTATTGCTCACAAATTGAGGATCTCATGTTTGAGTTATCTATGTGGCGATGT
AACGAGGAGCTACGCTCACGAGCTGATGATCTGCACCGCTCTTCTAAGAAGGACGCAAAG
CATTACATAGAGTTTTGGAAGAAGGTTCCTCTGAATGAACCATACCGGGTGATACTGAGT
GATGTGAGAGATAAGCTTTACAATACACGTGAACGATCACGGGAGTTGTTGTCCAGCGGA
TATTGCGACATCCCTGAGGAAGCAACTCTGACAAATGTTGAGCAGCTATTGGAGCCCTTG
GAGCTATGCTACAGGTCGCTGTGCGCCTGTGGTGACCGTGCCATCGCTGATGGAAGCCTT
CTTGATTTCTTGCGCCAAGTTTCCACCTTTGGACTCTCCCTTGTGAGGCTTGACATTAGG
CAAGAATCCGACAGACACACCGATGTCCTTGATGCCATCACGACATACCTGGGCATAGGA
TCTTACCGTGAGTGGTCCGAGGAACGCCGTCAAGAGTGGCTGTTGTCCGAACTCAACGGG
AAGCGACCATTGTTTGGCCCAGACCTTCCCAGGACAGATGAGGTTGCTGATGTTCTAGAC
ACATTCCATGTGATTGCCGAGCTCCCTGCTGACAGTTTTGGAGCCTATGTTATTTCCATG
GCAACAGCCCCCTCGGATGTCCTTGCTGTTGAGCTCCTCCAACGCGAGTGCCATGTCAAG
ACACCGCTTAGAGTTGTCCCCCTGTTCGAGAAGTTGGCTGATCTTGAGTCTGCCCCTGCG
GCATTGACCAGGCTCTTCTCAATAAGTTGGTACAGGCAGAGGATCAATGGTAAGCAGGAG
GTCATGATTGGGTATTCAGATTCAGGCAAGGATGCTGGCCGTCTCTCGGCAGCTTGGCAG
ATGTACAAGGCTCAGGAGCAGCTCGTCAAGGTAGCGAAGGATTTCGGGGTCAAGTTGACG
ATGTTCCATGGACGAGGTGGAACCGTTGGTAGGGGCGGTGGGCCGACTCACCTTGCCATC
TTGTCTCAGCCTCCAGACACGATCAACGGATCGCTCCGTGTCACTGTTCAGGGTGAAGTC
ATTGAGCAGAGCTTTGGTGAGGAGCACTTGTGTTTCAGGACACTGCAGCGTTTCACCGCT
GCTACACTTGAGCACGGCATGCATCCACCCAGTGCACCGAAGCCAGAATGGCGAGCTCTT
CTTGATGAGATGGCTGTGGTGGCAACCAAGGAGTATCGATCCGTAGTGTTCCAAGAGCCA
CGCTTTGTGGAGTATTTCCGCCTTGCAACACCTGAGACAGAGTATGGAAGGATGAACATA
GGAAGCAGGCCATCCAAGAGGAAGCCGAGTGGAGGCATTGAATCACTCCGTGCGATCCCA
TGGATCTTCGCATGGACGCAGACCCGCTTCCACCTTCCCGTCTGGCTTGGATTCGGTGCT
GCATTCAAGCACGCCCTTCAGAAGGACATCAGGAATCTCCACATGCTCCAGGAGATGTAC
AACGAGTGGCCGTTCTTCAGGGTCACTCTCGACCTGATTGAGATGGTTTTCGCCAAGGGT
AATCCTGGCATTGCTGCCCTTTACGACAAACTCCTCGTTTCTGAGGATCTACAGCCACTG
GGTGAGAAGCTGAGAGCCAACTATGTAGAGACACAAAAGCTGCTTCTTCAGGTTGCTGGC
CATAGGGATCTTCTTGAAGGTGACCCCTACCTGAAGCAGCGGCTCCGACTCCGCGACGCC
TACATAACCACCCTGAATGTCTGCCAAGCCTACACGCTGAAACGGATCCGCGACCCGGAT
TACCACGTCACGCTGCGCCCTCACCTGTCCAAGGAGGTGATGGATGGGAGCAAGCCGGCC
GCGGAGCTTGTGAAGCTGAACCCGGGTAGCGAGTACGCGCCAGGGCTGGAGGACACCCTC
ATCCTGACCATGAAGGGCATTGCTGCAGGGTTGCAGAACACTGGTTAA

Protein

976 aa

>Os09t0315700-01 Phosphoenolpyruvate carboxylase family protein.
MSAMSAAGGGGGVGKVERLSSIDAQLRQLVPAKLSEDDKLIEYDALLLDRFLDVLHGLHG
DDLKDLVQECYEVAAEYETKHDVQKLDELGNMITSLDPGDSIVIAKAFSHMLNLANLAEE
VQIAYRRRIKLKKGDFADENSAMTESDIEETLKRLVFDLKKSPAEVFDALKSQTVDLVLT
AHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQP
TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDG
NPRVTPEVTRDVCLLARMMAANLYCSQIEDLMFELSMWRCNEELRSRADDLHRSSKKDAK
HYIEFWKKVPLNEPYRVILSDVRDKLYNTRERSRELLSSGYCDIPEEATLTNVEQLLEPL
ELCYRSLCACGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITTYLGIG
SYREWSEERRQEWLLSELNGKRPLFGPDLPRTDEVADVLDTFHVIAELPADSFGAYVISM
ATAPSDVLAVELLQRECHVKTPLRVVPLFEKLADLESAPAALTRLFSISWYRQRINGKQE
VMIGYSDSGKDAGRLSAAWQMYKAQEQLVKVAKDFGVKLTMFHGRGGTVGRGGGPTHLAI
LSQPPDTINGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPSAPKPEWRAL
LDEMAVVATKEYRSVVFQEPRFVEYFRLATPETEYGRMNIGSRPSKRKPSGGIESLRAIP
WIFAWTQTRFHLPVWLGFGAAFKHALQKDIRNLHMLQEMYNEWPFFRVTLDLIEMVFAKG
NPGIAALYDKLLVSEDLQPLGEKLRANYVETQKLLLQVAGHRDLLEGDPYLKQRLRLRDA
YITTLNVCQAYTLKRIRDPDYHVTLRPHLSKEVMDGSKPAAELVKLNPGSEYAPGLEDTL
ILTMKGIAAGLQNTG*

5'UTR

chr09:8697349..8697399 (- strand) : 51 bp

CDS

chr09:8697151..8697348 (- strand) : 198 bp

chr09:8695895..8696286 (- strand) : 392 bp

chr09:8695725..8695809 (- strand) : 85 bp

chr09:8695388..8695610 (- strand) : 223 bp

chr09:8695130..8695233 (- strand) : 104 bp

chr09:8694957..8695044 (- strand) : 88 bp

chr09:8694690..8694844 (- strand) : 155 bp

chr09:8693604..8694602 (- strand) : 999 bp

chr09:8692906..8693292 (- strand) : 387 bp

chr09:8692487..8692783 (- strand) : 297 bp

3'UTR

chr09:8692296..8692486 (- strand) : 191 bp

FASTA

>Os09t0315700-01 class=Sequence position=chr09:8692296..8697399 (- strand)
ACCAAGTTCG CAGCAGCAAT CGTCTTCCTC TTCTTCTTGT TGTTGTTGGC GATGTCGGCG ATGTCGGCGG CGGGCGGCGG
CGGCGGCGTG GGGAAGGTGG AGCGGCTGTC GTCGATCGAC GCGCAGCTGC GGCAGCTGGT GCCGGCGAAG CTGTCGGAGG
ACGACAAGCT CATCGAGTAC GACGCGCTCC TCCTCGACCG ATTCCTCGAC GTCCTCCATG GCCTCCACGG CGACGACCTC
AAGGATCTCG TAATTTATCC AACCCTTTTC TTCTTCTTCT TTTTCTTTTT CTTTTTTCTT TTTTTGGTTG CAATCTTGGA
TTGGAGCAAT ACTATGTATG AGTGTGAGTA TGTGAATCCA GCTGAGCTTT TCGTTCCAGG GCAACACGTG GCATTGTTTT
GATTGGGATT TTTAGTTCAG TAGGTTTTAC TTTTAAGTGT GCAGATTGGG TTTGGATTTG TTACTACTCT TTAATCTTTA
GTGGGGGGTA AATTTGTGTA TGGTTAATTC TGTGCTTTAT TAATTATTAG TATGGGTTTA GTGTAAAGCT TGAATCTTGG
AGGTGAATTA GTGTTCTCTG ATTTGTTCAG TTGTTTGTGT GCTGATTTAG TGTTCTGGGT ACTGAGACTG AGCATACCAG
TGGATTCTGT TCTTGATTAG GCCCCTTCTT TTTTTTTTCC TAAACTCGTG GTTAGCTTAG GGGTTAATAA TAGCTGATCT
GTAAATTGTG TCAGTCAAAC TTTACCTCAT CTGTTTGGGA TCTCTTGTTG AATCAATTAA AATAACTGTT TTTTTTTTTA
CTGACAAGGA TCTATACTAG TAATGAAGCC TGCAGAGTTT GACCGTATCA ATTAATTTTG GTTCTCAGTA AAAACACACT
GTTCAAGTAT GCATGGGGTT ATGGGTGTGT TGTTTCTCAG GAAACAGAGT TGATTGCAGA GTCTTCTTCC TTTATATACC
TTCCTGTAAA CTGAACCTGA ATCCATACAA ATAATTTTAG CAAATGTACA AATAATTTTG ATTCTTTCCG TGTTCATCTT
TTCATTGTTG TTTATTACGA TTTAATTAGA AGGGATTGCC ACCTTTAAAC TGAATTTGCG TGCTACATGA TAGGTTCAAG
AATGCTATGA GGTGGCCGCG GAGTATGAAA CAAAGCACGA CGTGCAAAAG CTCGATGAAC TCGGCAACAT GATAACAAGC
TTGGATCCGG GCGACTCGAT TGTTATTGCG AAAGCCTTTT CGCACATGCT TAACTTGGCC AACTTGGCTG AAGAAGTCCA
GATCGCATAC AGGAGGAGGA TCAAGCTCAA GAAGGGTGAT TTCGCTGACG AAAACTCGGC AATGACTGAA TCCGACATTG
AGGAAACACT CAAGAGGCTT GTTTTTGACC TGAAGAAATC CCCTGCTGAG GTCTTTGATG CCCTCAAGAG TCAGACTGTT
GACCTTGTTT TGACTGCACA TCCAACACAG TCTGTGAGGA GGTCACTGCT CCAGAAACAC TCCAGGTTAG TCGGCGAAAC
AGCGCGATTT GCTCACACCA CATGATGTAG TTTCTAGTCT CTAATCTCGA TTGTAACATT CTTATTTCAG GATTCGGAAC
TGTCTGGTTC AGCTTTATTC AAAGGATATC ACTCCAGATG ACAAGCAAGA GCTTGATGAG GCTCTCCAGA GAGAGGTACT
TGTTGCAAAC ATTATGTTCA TTTACAAAAT GCTTTGCATT ATTTTCAGCA TGAGGTCAGA AAGATCCATA ATCCATTCTT
ATGCTTCACC TGACATCCTA TTATTTTAGA TCCAAGCTGC CTTTAGAACC GATGAGATCC GAAGAACACA GCCCACTCCC
CAAGATGAAA TGCGTGCTGG CATGAGCTAC TTCCATGAAA CAATATGGAA GGGTGTTCCA AAGTTCTTGC GCCGTGTGGA
TACTGCATTG AAGAACATCG GTATCGACGA GCGTGTTCCT TACAATGCTC CTCTTATTCA GTTCTCGTCT TGGATGGGAG
GAGATCGTGA TGGTGAGAAA CATATCTATT TTGTTGTTGG TTCTTAGCAC TATGCCTTAT AAATAATTAC AGCACAATGA
ATCCTCTTTA GATGTTGTCT TTAAATTACT ACCACTTAGG AGATACCATG TCTGTATGCA CTCTAAATTT CAAATGACCT
TTACAGGAAA TCCAAGAGTC ACACCAGAGG TTACAAGGGA TGTCTGCTTG CTTGCAAGAA TGATGGCAGC AAACTTGTAT
TGCTCACAAA TTGAGGATCT CATGTTTGAG GTACAATTTG ATTTGACTAT TTTAAAGTAC AGTAATTATT ATGCATATGA
TTGTTGGATA TTGATAAAGC TTTAAATGAT TTCAGTTATC TATGTGGCGA TGTAACGAGG AGCTACGCTC ACGAGCTGAT
GATCTGCACC GCTCTTCTAA GAAGGACGCA AAGCATTACA TAGGTACAGT TACAGCATTT TGGGCTTAAC TAATGATGTA
GGTTGCTACA AGAGGCCATT TTTGGAAAAA AAAAAAGATT CTAATTGTTG TTTTTTTGTT GAATCTTGGA TGCAGAGTTT
TGGAAGAAGG TTCCTCTGAA TGAACCATAC CGGGTGATAC TGAGTGATGT GAGAGATAAG CTTTACAATA CACGTGAACG
ATCACGGGAG TTGTTGTCCA GCGGATATTG CGACATCCCT GAGGAAGCAA CTCTGACAAA TGTTGAGCAG GTATAGAAAT
TCCCAGCAAA AATCAATAAT TTCCATGTAT AACATATGTT CAACGATTTT TTAACACATA TTTATCTTCT GTTTCAGCTA
TTGGAGCCCT TGGAGCTATG CTACAGGTCG CTGTGCGCCT GTGGTGACCG TGCCATCGCT GATGGAAGCC TTCTTGATTT
CTTGCGCCAA GTTTCCACCT TTGGACTCTC CCTTGTGAGG CTTGACATTA GGCAAGAATC CGACAGACAC ACCGATGTCC
TTGATGCCAT CACGACATAC CTGGGCATAG GATCTTACCG TGAGTGGTCC GAGGAACGCC GTCAAGAGTG GCTGTTGTCC
GAACTCAACG GGAAGCGACC ATTGTTTGGC CCAGACCTTC CCAGGACAGA TGAGGTTGCT GATGTTCTAG ACACATTCCA
TGTGATTGCC GAGCTCCCTG CTGACAGTTT TGGAGCCTAT GTTATTTCCA TGGCAACAGC CCCCTCGGAT GTCCTTGCTG
TTGAGCTCCT CCAACGCGAG TGCCATGTCA AGACACCGCT TAGAGTTGTC CCCCTGTTCG AGAAGTTGGC TGATCTTGAG
TCTGCCCCTG CGGCATTGAC CAGGCTCTTC TCAATAAGTT GGTACAGGCA GAGGATCAAT GGTAAGCAGG AGGTCATGAT
TGGGTATTCA GATTCAGGCA AGGATGCTGG CCGTCTCTCG GCAGCTTGGC AGATGTACAA GGCTCAGGAG CAGCTCGTCA
AGGTAGCGAA GGATTTCGGG GTCAAGTTGA CGATGTTCCA TGGACGAGGT GGAACCGTTG GTAGGGGCGG TGGGCCGACT
CACCTTGCCA TCTTGTCTCA GCCTCCAGAC ACGATCAACG GATCGCTCCG TGTCACTGTT CAGGGTGAAG TCATTGAGCA
GAGCTTTGGT GAGGAGCACT TGTGTTTCAG GACACTGCAG CGTTTCACCG CTGCTACACT TGAGCACGGC ATGCATCCAC
CCAGTGCACC GAAGCCAGAA TGGCGAGCTC TTCTTGATGA GATGGCTGTG GTGGCAACCA AGGAGTATCG ATCCGTAGTG
TTCCAAGAGC CACGCTTTGT GGAGTATTTC CGCCTTGTAA GTCCTTTCTC CCATTTATCA TCTTCAATTC TTCATCAGAC
TAGTAAAACC TCTAAAATAG ATTGAAAAGT GAAAACTTAA ACTTAAAAGT AATTATTTGC TTTGTGCAAT GATTTACCAT
GACAATCTTA TACTTTGATG AAATAATTGT AAGATAGTGA ACTAATGCAA CTTAGGAGTA GCATACCGTG CCACTGTTAT
TTTTGTGATG GAACAGTGTA AACTAGACTA AAGATAACCT TGGAGCCATT GAATTAGACT TATTAGACTT TTTCAAAATT
ATAATTTGTG TTGTTTGTGG TTGGCAGGCA ACACCTGAGA CAGAGTATGG AAGGATGAAC ATAGGAAGCA GGCCATCCAA
GAGGAAGCCG AGTGGAGGCA TTGAATCACT CCGTGCGATC CCATGGATCT TCGCATGGAC GCAGACCCGC TTCCACCTTC
CCGTCTGGCT TGGATTCGGT GCTGCATTCA AGCACGCCCT TCAGAAGGAC ATCAGGAATC TCCACATGCT CCAGGAGATG
TACAACGAGT GGCCGTTCTT CAGGGTCACT CTCGACCTGA TTGAGATGGT TTTCGCCAAG GGTAATCCTG GCATTGCTGC
CCTTTACGAC AAACTCCTCG TTTCTGAGGA TCTACAGCCA CTGGGTGAGA AGCTGAGAGC CAACTATGTA GAGACACAAA
AGCTGCTTCT TCAGGTATGT TCACTAAAAA CTTCAACCAG TACAATTCCA ACTTGTACAG TACTCTGAAC TCCTGATTAC
TCCTTGTTAT CATACAAAAG ATAGTACAAT GATTGGCTTT TTTTTTTTTA CTTCAGGTTG CTGGCCATAG GGATCTTCTT
GAAGGTGACC CCTACCTGAA GCAGCGGCTC CGACTCCGCG ACGCCTACAT AACCACCCTG AATGTCTGCC AAGCCTACAC
GCTGAAACGG ATCCGCGACC CGGATTACCA CGTCACGCTG CGCCCTCACC TGTCCAAGGA GGTGATGGAT GGGAGCAAGC
CGGCCGCGGA GCTTGTGAAG CTGAACCCGG GTAGCGAGTA CGCGCCAGGG CTGGAGGACA CCCTCATCCT GACCATGAAG
GGCATTGCTG CAGGGTTGCA GAACACTGGT TAAGACTTAG GAGAGATTGC CTGAGTGCCA TCTTTTTTGT ATCTTTCCTT
TGATCATTTG CCTTGGGCCC TGTTATTTTG GATACTGCTG AATATTGGTC TCCTTACTGA GGGAGGGGTA ACAAATACCG
GCGTTTTTTT GCCTATGTAT ATTATTACTG AAATAAAAGG AGACCATGAT CATTATAATA ACCT