Os09t0440300-01

Locus

Os09g0440300

Description

Similar to Aldehyde dehydrogenase family 7 member A1 (EC 1.2.1.3) (Antiquitin 1) (Matured fruit 60 kDa protein) (MF-60).

Transcript Evidence

AK119560 (DDBJ, Best hit)

Protein Evidence

Q9FPK6 (UniProt)

CGSNL Gene Symbol

ALDH7

CGSNL Gene Name

ALDEHYDE DEHYDROGENASE 7

CGSNL Gene Symbol Synonym(s)

OsALDH7, osaldh7

CGSNL Gene Name Synonym(s)

Oryza sativa Aldehyde Dehydrogenase 7, Family 7 ALDH.

Literature (PMID)

Manual Curation

Note

GO

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620)

InterPro

Aldehyde dehydrogenase domain (IPR015590)

Aldehyde dehydrogenase, conserved site (IPR016160)

Aldehyde/histidinol dehydrogenase (IPR016161)

Aldehyde dehydrogenase, N-terminal (IPR016162)

Aldehyde dehydrogenase, C-terminal (IPR016163)

KEGG

Os09t0440300-01 (EC:1.2.1.3)

KOME

002-113-B08 (Online Clone Ordering)

RiceXPro Database

AK119560

Oryzabase

8278

Plant Gene Family Database (PGFD)

Os09t0440300-01

Transcript

1995 bp

>Os09t0440300-01 Similar to Aldehyde dehydrogenase family 7 member A1 (EC 1.2.1.3) (Antiquitin 1) (Matured fruit 60 kDa protein) (MF-60).
ACTCCACCGCCTCCGTATAAGTATCCCTTCCTTACCGCCGGCCAGCCACAGCCACCGCCT
CCCCCACCCCACCCCGATCCCCTCCCCGCCGTACGGGCGCAGAAGGAACCCGTCTTCTAG
AAGGAGGAGGAGGGCTACCTCTCTCTCTCTCTCTTCTGCCATGGGGAGCTTCGCGAGGAA
GGAGCACCAGTTCCTCGCCGAGCTTGGCCTCGCGCCGCGGAACCCCGGGTCCTTCGCCTG
CGGCGCCTGGGGCGGCTCGGGCCCCGTCGTCACGTCCACCAACCCGACGAACAACCAGGT
CATCGCGGAGGTCGTGGAGGCGTCCGCGCGTGAGTACGAGGAGGGCATGCGCGCCTGCTA
CGATGCCGCCAAGACCTGGATGGCGATTCCAGCTCCAAAGCGAGGAGAAATTGTTAGGCA
AATTGGTGATGCATTGAGAGCAAAGCTCCATCACCTGGGCAGGCTTGTGTCACTTGAGAT
GGGGAAAATTCTTCCTGAAGGGATTGGAGAGGTTCAGGAAATCATTGACATGTGTGATTA
TGCTGTGGGCCTAAGTCGCCAGCTAAATGGGTCCATCATACCATCTGAACGCCCGAATCA
TATGATGATGGAGGTGTGGAATCCTCTTGGAGTTGTTGGTGTTATCACAGCATTCAATTT
TCCTTGTGCTGTGCTGGGTTGGAATGCCTGCATAGCTTTGGTATGTGGAAACTGTGTTGT
CTGGAAAGGTGCTCCAACTACTCCGTTGATCACTATTGCAATGACTAAAATAGTTGCCAG
TGTATTGGAGAGGAACAACTTGCCAGGCTCAATTTTTACAGCATTCTGTGGTGGTGCTGA
CATTGGCCAAGCAATTTCTCTTGACACAAGGATACCCTTGGTTTCATTCACAGGAAGCAC
AAAGGTTGGTCTAATGGTTCAGCAGCAAGTGAATGCAAGATTTGGCAAATGCCTTCTTGA
ACTTAGTGGGAACAATGCCATTATTGTAATGGATGATGCAGACATTCAGCTAGCTGTCCG
TTCAGTGTTGTTTGCTGCTGTTGGAACAGCAGGACAACGCTGCACTACATGTCGTAGGCT
GCTTCTTCACGAAAGCATATACCGAACATTTCTTGATCAACTTGTTGAGGTTTATAAACA
AGTCCGAATTGGGGATCCTTTGGAGAATGGTACGTTACTGGGGCCATTGCACACTCCTGC
TTCAAGAGACGCCTTCTTGAAAGGCATCCAAACCATCAGATCTCAGGGGGGAAAAATTCT
TTATGGAGGATCTGCAATTGAATCTGAGGGAAACTTTGTTCAGCCAACAATTGTGGAAAT
TTCACCCTCTGCACCGGTTGTGAGAGAAGAACTCTTTGGTCCTGTTCTTTATGTGATGAA
AGTTCAGAATCTGAAGGAAGCAGTTGAAATCAACAATTCTGTTCCTCAAGGATTGAGCAG
TTCTATATTTACAAAGAGACCAGATATTATTTTCAAGTGGATTGGGCCTCATGGTAGTGA
CTGTGGCATTGTTAATGTAAATATTCCCACAAATGGTGCTGAAATTGGTGGAGCTTTTGG
TGGAGAAAAAGCTACTGGTGGTGGACGAGAAGCAGGGAGTGATTCGTGGAAGCAGTACAT
GAGGAGGGCCACTTGTACGATCAACTATGGAAGCGAGCTGCCTCTAGCACAAGGAATAAA
TTTTGGCTAGTTCGGTGGTCAAGATCGGCTGATGAACATGTTAAGCTTCATCGACAGACT
TCAGGAATTTCTACTGGCGTCAACTGAAAACCGAAACTTCAACGCAGCAGCATTGCTATG
TGTGCATATAATAAGAGATGAGTCCAATATTAATGCATGTACTGCTCTTGCTATGATTAG
CCGTCGGAGTTCGAGTCCAATAAACAGGGAAAAATTGCGTATTCCCTGATCGGTTGATAT
GTACCAACATTTCTGATGTAATCTTTAGAACGGTATCGGTTGAAAACTTGAAATGAACGA
AAACGCGGTAAGAAT

CDS

1530 bp

>Os09t0440300-01 Similar to Aldehyde dehydrogenase family 7 member A1 (EC 1.2.1.3) (Antiquitin 1) (Matured fruit 60 kDa protein) (MF-60).
ATGGGGAGCTTCGCGAGGAAGGAGCACCAGTTCCTCGCCGAGCTTGGCCTCGCGCCGCGG
AACCCCGGGTCCTTCGCCTGCGGCGCCTGGGGCGGCTCGGGCCCCGTCGTCACGTCCACC
AACCCGACGAACAACCAGGTCATCGCGGAGGTCGTGGAGGCGTCCGCGCGTGAGTACGAG
GAGGGCATGCGCGCCTGCTACGATGCCGCCAAGACCTGGATGGCGATTCCAGCTCCAAAG
CGAGGAGAAATTGTTAGGCAAATTGGTGATGCATTGAGAGCAAAGCTCCATCACCTGGGC
AGGCTTGTGTCACTTGAGATGGGGAAAATTCTTCCTGAAGGGATTGGAGAGGTTCAGGAA
ATCATTGACATGTGTGATTATGCTGTGGGCCTAAGTCGCCAGCTAAATGGGTCCATCATA
CCATCTGAACGCCCGAATCATATGATGATGGAGGTGTGGAATCCTCTTGGAGTTGTTGGT
GTTATCACAGCATTCAATTTTCCTTGTGCTGTGCTGGGTTGGAATGCCTGCATAGCTTTG
GTATGTGGAAACTGTGTTGTCTGGAAAGGTGCTCCAACTACTCCGTTGATCACTATTGCA
ATGACTAAAATAGTTGCCAGTGTATTGGAGAGGAACAACTTGCCAGGCTCAATTTTTACA
GCATTCTGTGGTGGTGCTGACATTGGCCAAGCAATTTCTCTTGACACAAGGATACCCTTG
GTTTCATTCACAGGAAGCACAAAGGTTGGTCTAATGGTTCAGCAGCAAGTGAATGCAAGA
TTTGGCAAATGCCTTCTTGAACTTAGTGGGAACAATGCCATTATTGTAATGGATGATGCA
GACATTCAGCTAGCTGTCCGTTCAGTGTTGTTTGCTGCTGTTGGAACAGCAGGACAACGC
TGCACTACATGTCGTAGGCTGCTTCTTCACGAAAGCATATACCGAACATTTCTTGATCAA
CTTGTTGAGGTTTATAAACAAGTCCGAATTGGGGATCCTTTGGAGAATGGTACGTTACTG
GGGCCATTGCACACTCCTGCTTCAAGAGACGCCTTCTTGAAAGGCATCCAAACCATCAGA
TCTCAGGGGGGAAAAATTCTTTATGGAGGATCTGCAATTGAATCTGAGGGAAACTTTGTT
CAGCCAACAATTGTGGAAATTTCACCCTCTGCACCGGTTGTGAGAGAAGAACTCTTTGGT
CCTGTTCTTTATGTGATGAAAGTTCAGAATCTGAAGGAAGCAGTTGAAATCAACAATTCT
GTTCCTCAAGGATTGAGCAGTTCTATATTTACAAAGAGACCAGATATTATTTTCAAGTGG
ATTGGGCCTCATGGTAGTGACTGTGGCATTGTTAATGTAAATATTCCCACAAATGGTGCT
GAAATTGGTGGAGCTTTTGGTGGAGAAAAAGCTACTGGTGGTGGACGAGAAGCAGGGAGT
GATTCGTGGAAGCAGTACATGAGGAGGGCCACTTGTACGATCAACTATGGAAGCGAGCTG
CCTCTAGCACAAGGAATAAATTTTGGCTAG

Protein

510 aa

>Os09t0440300-01 Similar to Aldehyde dehydrogenase family 7 member A1 (EC 1.2.1.3) (Antiquitin 1) (Matured fruit 60 kDa protein) (MF-60).
MGSFARKEHQFLAELGLAPRNPGSFACGAWGGSGPVVTSTNPTNNQVIAEVVEASAREYE
EGMRACYDAAKTWMAIPAPKRGEIVRQIGDALRAKLHHLGRLVSLEMGKILPEGIGEVQE
IIDMCDYAVGLSRQLNGSIIPSERPNHMMMEVWNPLGVVGVITAFNFPCAVLGWNACIAL
VCGNCVVWKGAPTTPLITIAMTKIVASVLERNNLPGSIFTAFCGGADIGQAISLDTRIPL
VSFTGSTKVGLMVQQQVNARFGKCLLELSGNNAIIVMDDADIQLAVRSVLFAAVGTAGQR
CTTCRRLLLHESIYRTFLDQLVEVYKQVRIGDPLENGTLLGPLHTPASRDAFLKGIQTIR
SQGGKILYGGSAIESEGNFVQPTIVEISPSAPVVREELFGPVLYVMKVQNLKEAVEINNS
VPQGLSSSIFTKRPDIIFKWIGPHGSDCGIVNVNIPTNGAEIGGAFGGEKATGGGREAGS
DSWKQYMRRATCTINYGSELPLAQGINFG*

5'UTR

chr09:16338352..16338511 (- strand) : 160 bp

CDS

chr09:16338213..16338351 (- strand) : 139 bp

chr09:16337994..16338079 (- strand) : 86 bp

chr09:16337061..16337192 (- strand) : 132 bp

chr09:16336615..16336687 (- strand) : 73 bp

chr09:16335982..16336004 (- strand) : 23 bp

chr09:16335829..16335892 (- strand) : 64 bp

chr09:16335435..16335480 (- strand) : 46 bp

chr09:16334981..16335161 (- strand) : 181 bp

chr09:16334592..16334768 (- strand) : 177 bp

chr09:16334352..16334516 (- strand) : 165 bp

chr09:16333741..16333881 (- strand) : 141 bp

chr09:16333524..16333621 (- strand) : 98 bp

chr09:16332791..16332940 (- strand) : 150 bp

chr09:16330436..16330490 (- strand) : 55 bp

3'UTR

chr09:16330131..16330435 (- strand) : 305 bp

FASTA

>Os09t0440300-01 class=Sequence position=chr09:16330131..16338511 (- strand)
ACTCCACCGC CTCCGTATAA GTATCCCTTC CTTACCGCCG GCCAGCCACA GCCACCGCCT CCCCCACCCC ACCCCGATCC
CCTCCCCGCC GTACGGGCGC AGAAGGAACC CGTCTTCTAG AAGGAGGAGG AGGGCTACCT CTCTCTCTCT CTCTTCTGCC
ATGGGGAGCT TCGCGAGGAA GGAGCACCAG TTCCTCGCCG AGCTTGGCCT CGCGCCGCGG AACCCCGGGT CCTTCGCCTG
CGGCGCCTGG GGCGGCTCGG GCCCCGTCGT CACGTCCACC AACCCGACGA ACAACCAGGC GCGTCTCCCC CCACACGATC
CGCTCGGTTC TAGGCGCTCG ATTTGGTTTG GGCCGCCCTG GCATTTTTGG GGTGTGTGTG ATTGTGGTGG ATTTTGATGG
GGGATTTTTT TTTGGGTGTT TTGTGGTTTA GGTCATCGCG GAGGTCGTGG AGGCGTCCGC GCGTGAGTAC GAGGAGGGCA
TGCGCGCCTG CTACGATGCC GCCAAGACCT GGATGGCGGT GAGTTTCACT TGACTTGCTG TGTTGGAGTG CTGATATCAA
TTCGTTCGGA TGATGAAGTG CTCGTACTAT GCTCTTGTGT GTCATTTGCT ATTTTCTGCT GCGTGAGAGA TCTGACTGTG
TGGAAACCAG CAATTGTGCA ATTCGAAACG TTGCGATATT ATTTGTTTGG AAATGCTGCC TCAAAACCCT GTAACTTGGG
TGTTTTGGGG GTTTCAGCTT TTGGTTACAG CCTTACAGGA ATCTGAGTCT GCTATAGCGC TCTAATGCAG CAAACAGTGT
TCGGTACTGT ACCTAATTTA CTGTACATGA TAATCATTAC TGTAGCGAAA GTGATGTAAC AACTCACCTT TACCATTAGT
CCGTTAATAA ACGACAAGGA TCAAGGGCTA ATTCCTGGTA CTATAGCCCT ATGCCGTAGC ATGGTGCTAC ATCAGAGGAT
CTCCTTCCTT TGAGAAGGTG GTATGGACTC GTTATATGAT TCAGGAACAC CAAAAATCTG ATATAAAATG GGAAATGGCA
AAGTAACAGT ATGTCCGATG TTAAAATGCT GATAAAGTAG AGACTGTGTG CAATGTGCAC ACTACGATTT CATATTTCAT
ACATGTTTTA ATTTATAAGA TTGTGATATC AAAATTTAAT TAAAATACAC ATGTATGTAT AAGCACACTA TGATGTATAG
AAGCTAGCAG CACTGTTATG ATGCAAAAAT TCAAATATGT GGAAGAAGCG CAGCTGAGAT CCCTTTTTTT AAGTTATTTT
ATTGTAAAAC TACTAACAGT TACATATTAA TATGTCCAGA TTCCAGCTCC AAAGCGAGGA GAAATTGTTA GGCAAATTGG
TGATGCATTG AGAGCAAAGC TCCATCACCT GGGCAGGCTT GTGTCACTTG AGATGGGGAA AATTCTTCCT GAAGGGATTG
GAGAGGTTCA GGTAGGTATA ATTGCCGCCA GTTCTTCCAC TCAGAGCTTC ATTGTTTTTT GCACTCAGGA TAGGAAATGA
CCACTATATT GTGTTTCTTC AGAATATTCA GTGATTTATC TTTAGAACAT TAATGGTGTG CTCATCACGA ATGCTTCATT
ATCATCAATA CCTTGCCTGC TAGAATTACC AACTTAGCCC CTAACATGAT ATGCAGTTGT GTTTCCTTTT CTCTCTGTTA
ATCATCTTTC TGCCAATCGA ATGTCTTGCC TAAGAATTTG GCCATTATTG AGATAATTTC ATGATCGAAT ATTTAACTGC
GACTATTGAT TCTCCACCAT GAAGGCATGA TTATGTTGAC ATAAATGTAA CCTCTGTTTT GTAGGAAATC ATTGACATGT
GTGATTATGC TGTGGGCCTA AGTCGCCAGC TAAATGGGTC CATCATACCA TCTGAACGTA AGCCCATTCT CCCTTTCCTA
ATTTATATCT GATGCCCGCT TCAAAGTATG ATAACAGCAG ATACTTCTGA TCATATTTTC TCTATTTGGT TGAGATACAA
ATATTATTAT ATCTTAATTC TGTCTGAAAA AGAATACCTC AATTGATTTA GGTTTCCAGG TTTTCTAATG AAATTAGTAC
TTCATTAGAA TAAGCAATTT TACTCCATTA TTACTAATTC GCTCTCTGGA TTATTTCATG TTAAGTGATT CTCCATTTCA
CTAATTTGAA CACACAATAT ACTTGCCATT CTAGTTTACT GTTCTATACA AAATCCTGTC CCTTGACATG CCATACCACC
ATTACTTATC AAAATGTGCC ATCACACGAT TTTCTGTAGT AATGATAAGA TATTCGCTGA TTGTCCGTTA GACAGCAATA
TTTTACAGAG TTATGCCCAA ATTATCACCA TTGGTTTTTG TGGTTAGGAT AGAAGGTTGA GCCATGGCGT TCTCAATTGT
AGTAATGTTG CCATTTATTC ATACTTATGG GATTGTAAAA TTCATCAATG CTCTGTTTGA TAAGTATACT GGAAGATTTT
CTAATGCTGT CTTCTACTTT TTTTCAGGCC CGAATCATAT GATGATGGAG GTAGGCACAA ACCAGTTCTT TTAACTCCAG
ATTTACTTTC TCTGTTTCTC ATGTGGAAGA AAGCTAATCC CTAAAGCTCA TTCAAATAGG TGTGGAATCC TCTTGGAGTT
GTTGGTGTTA TCACAGCATT CAATTTTCCT TGTGCTGTGC TGGGTAAGTG TCTTCTCTTA GAATATCATT AGTGAAATCA
ACTTAGTGCA TTGCAATTCC CTGTTATTTA CCCCTACATA CTCTTGATCT ATCAAATGCA AAATTGACAA GAACTTGACC
TATTGAAAAT TAACTGTTAT AATCCAATGA GTAGCCGTGT CCATATAATA GGATCTTCAA GGTGTCAATT TAGCCGCTTA
CTCTTTTGTT TATGATATAC ATGATATGTT GCATGTTTAT GCTATAATCT TTTGAATGCT ATGGTGCTGG CGACCTTTAT
CACATGCTCA AATTCTTGTA ATCCTTAACA GCGACTAATA CATCAATTAT TTCCTTTTTG TCATATTTTA GGTTGGAATG
CCTGCATAGC TTTGGTATGT GGAAACTGTG TTGTCTGGTA AGAATGATTT CCTTTCTCCA TAAACTGAAA GTACTGTCCT
ACTACATGTT ATCAGTACTG TAACTTTCTT TACTTATATT ATGGATGAGA GTATGCTCTT AAGTTGTATT CTCTGAACAT
TTCAATAGAT CATTAGCTTA GTGTTCCAGA TTATAATAAT TTCGTAATGT TCATTAAACT GGTGAAGGTC CATTATATCT
ATTGCATTTT CCTTGCATGA ACTGTCTTGG AACTGTCCTT TTTTTGTAAC TAATTTCTAA ACAATTGCAG GAAAGGTGCT
CCAACTACTC CGTTGATCAC TATTGCAATG ACTAAAATAG TTGCCAGTGT ATTGGAGAGG AACAACTTGC CAGGCTCAAT
TTTTACAGCA TTCTGTGGTG GTGCTGACAT TGGCCAAGCA ATTTCTCTTG ACACAAGGAT ACCCTTGGTT TCATTCACAG
GAAGCACAAA GGTATATACT ACAGTAAACT GCTACCTATG TCATCTATGC ATATTTCCTA ATCGATCCAT TTTGATATAA
TGACCTCCAT CACATCTCCA ATTTCTATTT CCTTTTGAGG TCCTTTTTTA ATTCTGAGCA GCTTTTTCAA GCATTTGATA
ATTATATATC ATTGAACTGT GCTGATCTAC TGCAAAATTT GTAACACTGA TTGCTCAATG CAGGTTGGTC TAATGGTTCA
GCAGCAAGTG AATGCAAGAT TTGGCAAATG CCTTCTTGAA CTTAGTGGGA ACAATGCCAT TATTGTAATG GATGATGCAG
ACATTCAGCT AGCTGTCCGT TCAGTGTTGT TTGCTGCTGT TGGAACAGCA GGACAACGCT GCACTACATG TCGTAGGCTG
GTAAGATAGG TTTTTCTTAT CTGCCCCAAT GGCTGGTGTA TGAGTAGTCT AAATGCTTTT GTTTTGTTAA CACAGCTTCT
TCACGAAAGC ATATACCGAA CATTTCTTGA TCAACTTGTT GAGGTTTATA AACAAGTCCG AATTGGGGAT CCTTTGGAGA
ATGGTACGTT ACTGGGGCCA TTGCACACTC CTGCTTCAAG AGACGCCTTC TTGAAAGGCA TCCAAACCAT CAGATCTCAG
GTGATATTAT TGATGCAACA ACATTTGCTT GTGCATCAAT GTCTGTTTGC ATTATATTAA ACAATCTTTA CATCTTCAAT
ACTTAAAATG CTTAAGTTGG TAGTGTTGAT GGCCTTTCTA CTCCTCCCTa taatctaaat aattcttaat atgttagcag
tcaaagtttt cttaatttgt tggcagtagt caaagttaaa gatgtttgat tgcatgcttt ctacaaaatt gtatttCTGA
ATGTATGGAG TTTATTATTC CCTGAATTCT GAATCTTGAA TGTACATCTT AAAATGCTGT GCTACTGGAA GTTGTTAGTT
CAGTATGTTT AACTAGAATC AATCTCATTA CATCACATAG GCACATTGCT GTGAATCTAT TAGAGCGAAA CCATTTAGCA
TTTACCTGTG GCCTTGAATT GGTTGGTGAT TTTCTGTAAG CAGTAATTTG ACTGACATCC TAATTTGCAG GGGGGAAAAA
TTCTTTATGG AGGATCTGCA ATTGAATCTG AGGGAAACTT TGTTCAGCCA ACAATTGTGG AAATTTCACC CTCTGCACCG
GTTGTGAGAG AAGAACTCTT TGGTCCTGTT CTTTATGTGA TGAAAGTTCA GGTATAAAAG ATTCAATTAC TTTGCTTTTA
TGTTATTGAT CTGTAATGTT TGGTGTCAGT TGTATAGTGT TGGACCAGAT CATTATCATT TACACTACTT TTCGTGGTCA
TTACCTGCAG AATCTGAAGG AAGCAGTTGA AATCAACAAT TCTGTTCCTC AAGGATTGAG CAGTTCTATA TTTACAAAGA
GACCAGATAT TATTTTCAAG TGGATTGGGT AAGTGTCAGT TCAACCACCT AGAAAGTAGC CCCCTTGCAG CTAAGCTTGA
TTGTTATAAA TAGAAATCAA GGCTCACTTT GGCACTAATG GATCTCCATC CTCCTGCTCA TATGTAGCAT TGTGTTTCCT
GATGTCCTAA ACTTGTTTTG GTGAAGGTAT CAGACTTGTT TGCTTTTACT TTAATCTCAT TGTTTCCCTG TTTATTGAAT
CACACTGAAA TATTATTCAA GTTTAACAGT TCAAATATAC TTAGGCTTTT AGACCCTTTT TCCGTTATGT GCATTATATG
CATTATTAGT GTATTAAATT CTTTTTTAAG ATGATATTTG ATGTCCATAT ATATTGACAC CTAAAAAGAA TCATAAAGCG
ATTTAACACT ACTGAATCCC CGCTATGTGT CATGACTAAA TCATTGACCA TATTCCTGTG TTGTGAAATC CCCCATATAA
TAAACCCTCT TCCGAGGACA GCTGCATGCC TACACCTTTC TTTTACACGC TCTCAGATTT CTTTTACTGC CATGCCCCAT
AAGACATGAA ATGACTATGG TAGTGATGTT CTTGCTCTTC TTGCTGTACA GGCCTCATGG TAGTGACTGT GGCATTGTTA
ATGTAAATAT TCCCACAAAT GGTGCTGAAA TTGGTGGAGC TTTTGGTGGA GAAAAAGCTA CTGGTGGTGG ACGAGAAGCA
GGGAGTGATT CGTGGAAGCA GTACATGAGG AGGGCCACTT GGTAAGTAGA CAAATTTTGA TTCAAGTATG CAAGCTATAC
CTTGATCAAT TGGTAAAATT CCTAGTTCCT TTTGCACTTT TCCCAAGTTG TCGTTTGCAA CAGCAGTAAC TGAATATTTA
CTGAAATGTA AACTGTTCAC TCCCATTGGT GAGTGGTGAC CTTGGCTTGG CATGATGGCT TCCTTAGAGA CTCTAGTACA
CTACAATGAT TAGCAAAgag taaagtccat caccggtcct taaacttgta ccgctgtatc atcccggtcc ctaaactcgc
aaatcgaccg ttcaagtcct caaacttgtt cgactgtgtc atcctagtct ctaaacttgt agatcactcg tttaggtcct
ccaacttatt cagttgtgtc accccggtcc ctaaacagga cggtctaaaa actttatatc aaaaaataat tcataacttt
ttcatgtgaa ctctgaagac aaactttata tcaaaattgt agctctcgac gcgacctaca actttgtagt tgaaaagttt
ttgaattaaa actgtttagg gtcccaaaat attgttgcat gtttatagat tttgaaattt taattttaaa attacatttt
gggacaaaaa atgactttaa ataaaaaaaa ttcaactaca aagttgtaga tcgcgtcgag ggctacaagt ttgatataaa
gtttgtcttc attagaattc atatgaaaaa gttatgaatt atttttaaat ataaagtctt tagaccatcc tatttgaccc
agatgatatt caaatccaag tttagggacc ggggtgacac aaccgaacaa gttggaggac ctaaatgagt gatctgcaag
tttagggacc gggatgacat agtcgaacaa gtttgaggac ctgaacggtc agtttgcgag tttagggacc gggatgacac
aacggtacaa gtttagggac cggtgatgga ctttactcAT TAGCAAACAA GGGGAACAAA TAATTGTTGA TAAATTACTG
TAATGAAGTT ATCATCTGTT GGAGTCTGTG TAAGCCTGTA AAATTGAAGT CCCtaaggtg gtgtttggca aggagggact
aaactttagt ccctctcaca aaaaatttag tccctatggg agggactttt gcttttgtga gagggactaa agtttagTTA
GGGACTAATT TTTTTGTGAG AGGGACTAAA GTTTAGTTAG GGACTAaggt ggtgtttgga tccagggact taactttagt
ctctatattt agacactaat ttagagtatt aaatatagac tacttacaaa attaattata taaatgaaag caaatttgcg
agacaaaatt tttaagccta attaatctat aattagagaa tgtttactgt agcatcacat aggctaatca tagattaatt
aggctcaata gattcgtctc gcgaattagt ccaagattat ggatgggttt tattaatagt ctacgtttaa tatttataat
tagtgcaaac attcgatgtg atagtgactt aaaagtttta gtcccatcta aacagggtct AATTTTTTTG TGAGAGGGAC
TAAAGTTTAG TCCCTCTTTC CCAAACACCA CCTAACTCTG TATCAAACTG CACGGAGAAT AATTTACATA ACCGGGATCC
AGCCACCACA GTACCTTCTT TTTTCACTGT GATTTTGAGT TTTGAAGTTT CTGGCTATTC TCTCATTGAT GTTACGATGT
ACATAAAACT AATCTACATA AGGATGCTGT AACATTTCGG TTGTGTAGAC ACCATTACGC CATAGAAATG TTGTCAGAAT
ATCATCTCTG CCACCGCCCA CCGGGCTATT CCATGTCATC CATTGTGATC ATTCTGACCT GGGATAGCAC TTTTACCCAA
AAGGCCTTGG GAGTACCATC ATACAAATAG AAGCTTAGAA TGCCATGAAG CAATAAATTC AAATAGAACT ACACATATAT
ATTACTCTAT TATTAGCACT GAGAAAACCA TTTGATTTGC TCTGCCATAT TTTTCAATGG GTATTTGCGA CGTCCCAAAA
CTCTGTGAAG CATAGGGATC ACAATATCTT ATGTATAGAT GTTCCCAATG AAAGGCTTAT CCTATGTACA TTGAATTCTA
GTTCCTTGAG ATGTGAACCA TGCCATGAAG ATAATTACTG CAAGAGTAGC TTCTGTTGCA AGATATTCAG GGCAATAATT
CTAGTGTGTG TTCACCATGC TCGAAATACT TTGCATAGAT AATTCTTTAT GTTATAGTTA TGCATTTCCT GCACACTAAT
TCTCAATCCA AATTTCTGCA GTACGATCAA CTATGGAAGC GAGCTGCCTC TAGCACAAGG AATAAATTTT GGCTAGTTCG
GTGGTCAAGA TCGGCTGATG AACATGTTAA GCTTCATCGA CAGACTTCAG GAATTTCTAC TGGCGTCAAC TGAAAACCGA
AACTTCAACG CAGCAGCATT GCTATGTGTG CATATAATAA GAGATGAGTC CAATATTAAT GCATGTACTG CTCTTGCTAT
GATTAGCCGT CGGAGTTCGA GTCCAATAAA CAGGGAAAAA TTGCGTATTC CCTGATCGGT TGATATGTAC CAACATTTCT
GATGTAATCT TTAGAACGGT ATCGGTTGAA AACTTGAAAT GAACGAAAAC GCGGTAAGAA T