Os09t0569200-01

Locus

Os09g0569200

Description

Similar to Beta-amylase (EC 3.2.1.2) (1,4-alpha-D-glucan maltohydrolase).

Transcript Evidence

AK070300 (DDBJ, Best hit)

Protein Evidence

B6SVZ0 (UniProt)

CGSNL Gene Symbol

CGSNL Gene Name

CGSNL Gene Symbol Synonym(s)

CGSNL Gene Name Synonym(s)

Literature (PMID)

Manual Curation

Note

GO

Biological Process: polysaccharide catabolic process (GO:0000272)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: beta-amylase activity (GO:0016161)

Molecular Function: cation binding (GO:0043169)

InterPro

Glycoside hydrolase, family 14B, plant (IPR001371)

Glycoside hydrolase, family 14 (IPR001554)

Glycoside hydrolase, subgroup, catalytic domain (IPR013781)

Glycoside hydrolase, superfamily (IPR017853)

Glycoside hydrolase, family 14, conserved site (IPR018238)

KEGG

Os09t0569200-01 (EC:3.2.1.2)

KOME

J023048N01 (Online Clone Ordering)

RiceXPro Database

AK070300

Plant Gene Family Database (PGFD)

Os09t0569200-01

Transcript

2144 bp

>Os09t0569200-01 Similar to Beta-amylase (EC 3.2.1.2) (1,4-alpha-D-glucan maltohydrolase).
GGGCTAATCATAATAATCATGATTTCTTCTCCTGCGCTCTTCTTCCTCCTCCAGCCAGGC
CGCCCCTCCATCGCCGCGCCGCCGCTCCCCTCCTCGCCGGCGCCTCCCCTCCGCGGCATC
TCCATCTCCCCCGTCGCCGCCCGCCCCATCTCCTCCCTCCGCTCCTCCTCCTCCATCAGG
ATCATCTCGCCGCCGCACGCCCTCCCCGACCCGCTCCTCTCCCTCCCGTCCATGGACCCC
CAAGAGGTGCCCGATCTGCTGCCCCCGCGCCCACCGGAGCGCGACTTCGCCGGAACGCCA
TACGTCCCCGTCTATGTCATGCTCCCGCTTGGAGTGGTCAATGGTAATGGCGAGGTGGTC
GACGCCGACGTCTTGGTGGGCCAGCTTCGGGTACTCAAGGCTGCCGGCGTCGATGGGGTC
ATGGTCGATTGCTGGTGGGGGAATGTCGAGGCCCACAGGCCGCAGGAGTACAATTGGACC
GGTTACAAGCGACTCTTCCATATGATCAGGGAGCTCAAGCTCAAGCTGCAGGTGGTCATG
TCATTCCATGAGTGTGGAGGCAATGTTGGAGATGATGTGTCTATTCCTCTCCCACATTGG
GTAACAGAGATCGGAAGAAGCAATCCAGATATCTACTTCACCGACAGGGCTGGCAGGCGT
AACACGGAGTGCCTTTCATGGGGCATTGATAAAGAAAGGGTTCTTCAAGGACGGACAGGG
GTCGAGGTATACTTTGACTACATGAGAAGCTTCCGAGTAGAATTTGATGAATATTTTGAG
GATGGTATCATTTCAGAAATTGAGATTGGGCTAGGGGCTTGTGGAGAGTTGAGGTATCCA
TCTTATCCAGCAAAACATGGGTGGAAATACCCTGGCATTGGAGAATTTCAGTGCTACGAC
AGATACTTACAGAAAAGTTTAAGAAGAGCTGCAGAAGCACGAGGACATACCATATGGGCA
AGAGCGCCAGACAGTGCAGGCCATTATAATTCTGAGCCAAATCTGACTGGATTTTTCTCT
GACGGAGGAGATTATGATAGCTACTATGGTCGTTTTTTCCTCAATTGGTATTCCCAGGTG
TTGGTGGATCATGCTGACCGTGTATTGATGTTAGCCAGGTTGGCTTTTGAAGGTTCAGAT
ATTGCTGTTAAGGTTTCAGGTGTACACTGGTGGTACAAAACTGCCAGTCATGCTGCTGAA
TTGACTGCTGGGTTTTATAACCCATGCAACCGTGATGGTTATGCCTCAATTGCTGCTGTC
CTGAAAAAACATGGTGCAGCTTTGAACTTTACATGTGTTGAACTGCGCACTATGGATCAG
CATGAGGTATTTCCTGAGGCCTTTGCAGATCCAGAGGGCCTTGTATGGCAGGTGCTAAAT
GCTGCATGGGATGCTGGCATACCAGTAGCTAGTGAGAATGCTCTGCCTTGCTACGATAGA
GATGGCTTTAACAAAATTTTGGAGAATGCAAAGCCACTGAATGATCCAGATGGGAGGCAT
TTACTAGGATTCACGTACCTGAGGCTCACCAAAGTCCTCTTCGAGAGAGCTAATTTTTTG
GAATTTGAGCGTTTCGTTAAGAGAATGCATGGTGAAGCAGTTCTCGATCTACAGGTATAA
GTTGTGTTCAGGGTTCTTACATACATACATATATATACATGCCATTGTAATTGGCATAGG
CCTTATGGCTTATGATGGGGGAACAGAGATGCCATTTTTGTTTCGTAGGTTGTTGTAGTA
TACCATCAGCAGATTTTTGAACTATAGAGGGTTTGGCTCCATGGTGTAAAGCATACCCTT
GGCAAAGAGTTGTCATGCAGAAAATTGATGGTTTCATTCGGAATGAGGTTGGAAGCAGGT
GTATTTCTTTCGATGCGGCAGACATATTTGATTTGTCATGAGATGAGGATTGGGTGAGCA
GGTGGTATCCTTCTGAAAGATTTGAGGCTGTATTGAAGAGAATGTGCTGATGCATGTTTA
TCATGGAGCAAGCGACATTAATGGAGTTAGCAAAGGTTCTCGCGGTGTATGTGTTTGTAT
TTGTTGGTGGAATGTCACTCGAGGATCTTGGCTGTATACAATACATACATGTGCTTTTTT
TTGGGTCTTTTCTACAGTGTATGAGAAATGCATGTTTCTTACTG

CDS

1602 bp

>Os09t0569200-01 Similar to Beta-amylase (EC 3.2.1.2) (1,4-alpha-D-glucan maltohydrolase).
ATGATTTCTTCTCCTGCGCTCTTCTTCCTCCTCCAGCCAGGCCGCCCCTCCATCGCCGCG
CCGCCGCTCCCCTCCTCGCCGGCGCCTCCCCTCCGCGGCATCTCCATCTCCCCCGTCGCC
GCCCGCCCCATCTCCTCCCTCCGCTCCTCCTCCTCCATCAGGATCATCTCGCCGCCGCAC
GCCCTCCCCGACCCGCTCCTCTCCCTCCCGTCCATGGACCCCCAAGAGGTGCCCGATCTG
CTGCCCCCGCGCCCACCGGAGCGCGACTTCGCCGGAACGCCATACGTCCCCGTCTATGTC
ATGCTCCCGCTTGGAGTGGTCAATGGTAATGGCGAGGTGGTCGACGCCGACGTCTTGGTG
GGCCAGCTTCGGGTACTCAAGGCTGCCGGCGTCGATGGGGTCATGGTCGATTGCTGGTGG
GGGAATGTCGAGGCCCACAGGCCGCAGGAGTACAATTGGACCGGTTACAAGCGACTCTTC
CATATGATCAGGGAGCTCAAGCTCAAGCTGCAGGTGGTCATGTCATTCCATGAGTGTGGA
GGCAATGTTGGAGATGATGTGTCTATTCCTCTCCCACATTGGGTAACAGAGATCGGAAGA
AGCAATCCAGATATCTACTTCACCGACAGGGCTGGCAGGCGTAACACGGAGTGCCTTTCA
TGGGGCATTGATAAAGAAAGGGTTCTTCAAGGACGGACAGGGGTCGAGGTATACTTTGAC
TACATGAGAAGCTTCCGAGTAGAATTTGATGAATATTTTGAGGATGGTATCATTTCAGAA
ATTGAGATTGGGCTAGGGGCTTGTGGAGAGTTGAGGTATCCATCTTATCCAGCAAAACAT
GGGTGGAAATACCCTGGCATTGGAGAATTTCAGTGCTACGACAGATACTTACAGAAAAGT
TTAAGAAGAGCTGCAGAAGCACGAGGACATACCATATGGGCAAGAGCGCCAGACAGTGCA
GGCCATTATAATTCTGAGCCAAATCTGACTGGATTTTTCTCTGACGGAGGAGATTATGAT
AGCTACTATGGTCGTTTTTTCCTCAATTGGTATTCCCAGGTGTTGGTGGATCATGCTGAC
CGTGTATTGATGTTAGCCAGGTTGGCTTTTGAAGGTTCAGATATTGCTGTTAAGGTTTCA
GGTGTACACTGGTGGTACAAAACTGCCAGTCATGCTGCTGAATTGACTGCTGGGTTTTAT
AACCCATGCAACCGTGATGGTTATGCCTCAATTGCTGCTGTCCTGAAAAAACATGGTGCA
GCTTTGAACTTTACATGTGTTGAACTGCGCACTATGGATCAGCATGAGGTATTTCCTGAG
GCCTTTGCAGATCCAGAGGGCCTTGTATGGCAGGTGCTAAATGCTGCATGGGATGCTGGC
ATACCAGTAGCTAGTGAGAATGCTCTGCCTTGCTACGATAGAGATGGCTTTAACAAAATT
TTGGAGAATGCAAAGCCACTGAATGATCCAGATGGGAGGCATTTACTAGGATTCACGTAC
CTGAGGCTCACCAAAGTCCTCTTCGAGAGAGCTAATTTTTTGGAATTTGAGCGTTTCGTT
AAGAGAATGCATGGTGAAGCAGTTCTCGATCTACAGGTATAA

Protein

534 aa

>Os09t0569200-01 Similar to Beta-amylase (EC 3.2.1.2) (1,4-alpha-D-glucan maltohydrolase).
MISSPALFFLLQPGRPSIAAPPLPSSPAPPLRGISISPVAARPISSLRSSSSIRIISPPH
ALPDPLLSLPSMDPQEVPDLLPPRPPERDFAGTPYVPVYVMLPLGVVNGNGEVVDADVLV
GQLRVLKAAGVDGVMVDCWWGNVEAHRPQEYNWTGYKRLFHMIRELKLKLQVVMSFHECG
GNVGDDVSIPLPHWVTEIGRSNPDIYFTDRAGRRNTECLSWGIDKERVLQGRTGVEVYFD
YMRSFRVEFDEYFEDGIISEIEIGLGACGELRYPSYPAKHGWKYPGIGEFQCYDRYLQKS
LRRAAEARGHTIWARAPDSAGHYNSEPNLTGFFSDGGDYDSYYGRFFLNWYSQVLVDHAD
RVLMLARLAFEGSDIAVKVSGVHWWYKTASHAAELTAGFYNPCNRDGYASIAAVLKKHGA
ALNFTCVELRTMDQHEVFPEAFADPEGLVWQVLNAAWDAGIPVASENALPCYDRDGFNKI
LENAKPLNDPDGRHLLGFTYLRLTKVLFERANFLEFERFVKRMHGEAVLDLQV*

5'UTR

chr09:22713282..22713299 (+ strand) : 18 bp

CDS

chr09:22713300..22713527 (+ strand) : 228 bp

chr09:22713614..22713694 (+ strand) : 81 bp

chr09:22713771..22713974 (+ strand) : 204 bp

chr09:22714160..22714354 (+ strand) : 195 bp

chr09:22714459..22714623 (+ strand) : 165 bp

chr09:22714896..22715156 (+ strand) : 261 bp

chr09:22715303..22715521 (+ strand) : 219 bp

chr09:22715680..22715899 (+ strand) : 220 bp

chr09:22715986..22716014 (+ strand) : 29 bp

3'UTR

chr09:22716015..22716538 (+ strand) : 524 bp

FASTA

>Os09t0569200-01 class=Sequence position=chr09:22713282..22716538 (+ strand)
GGGCTAATCA TAATAATCAT GATTTCTTCT CCTGCGCTCT TCTTCCTCCT CCAGCCAGGC CGCCCCTCCA TCGCCGCGCC
GCCGCTCCCC TCCTCGCCGG CGCCTCCCCT CCGCGGCATC TCCATCTCCC CCGTCGCCGC CCGCCCCATC TCCTCCCTCC
GCTCCTCCTC CTCCATCAGG ATCATCTCGC CGCCGCACGC CCTCCCCGAC CCGCTCCTCT CCCTCCCGTC CATGGACCCC
CAAGAGGTAC CTCTTCTTCT TCTTCTTCTT CTTCTATCAG CTACTACTAG TACGTTACGT ACGGGCATTC AACCTAGCTG
GCTTCACTGC AGGTGCCCGA TCTGCTGCCC CCGCGCCCAC CGGAGCGCGA CTTCGCCGGA ACGCCATACG TCCCCGTCTA
TGTCATGCTC CCGGTAGGTA CATCTCTCCT TCCATTCTCT TCCTCGCACC ACGCCGCTCG CTCTTATGTA TGTATGTTGC
TGTCTGTAGC TTGGAGTGGT CAATGGTAAT GGCGAGGTGG TCGACGCCGA CGTCTTGGTG GGCCAGCTTC GGGTACTCAA
GGCTGCCGGC GTCGATGGGG TCATGGTCGA TTGCTGGTGG GGGAATGTCG AGGCCCACAG GCCGCAGGAG TACAATTGGA
CCGGTTACAA GCGACTCTTC CATATGATCA GGGAGCTCAA GCTCAAGCTG CAGGTTATTC CTCCACTCCA CATTATATTG
TCATGCATGT CACCCTTTGT TGTTAATCAT GTTTTGGTGT TTATGCGCAT TTCAGATTTC AGTACCGTGC TAATACAGGA
TCTATTCATT TATCCTCTCC AATTTTACCC TTTCTTTCAT GGTGTTTCTT TTAATTTCTT GTCAAAATAC TTACTTAGGT
GGTCATGTCA TTCCATGAGT GTGGAGGCAA TGTTGGAGAT GATGTGTCTA TTCCTCTCCC ACATTGGGTA ACAGAGATCG
GAAGAAGCAA TCCAGATATC TACTTCACCG ACAGGGCTGG CAGGCGTAAC ACGGAGTGCC TTTCATGGGG CATTGATAAA
GAAAGGGTTC TTCAAGGACG GACAGGGGTC GAGGTATTCT ACCCACTTCT CTAATTACGC AATCCACTAA TTCTTAATGG
GAAGATCACA ATCCGTTGTG TTTATGTGTT TATCTGTTTC ATCCCTTATT GATTTAGGTA TACTTTGACT ACATGAGAAG
CTTCCGAGTA GAATTTGATG AATATTTTGA GGATGGTATC ATTTCAGAAA TTGAGATTGG GCTAGGGGCT TGTGGAGAGT
TGAGGTATCC ATCTTATCCA GCAAAACATG GGTGGAAATA CCCTGGCATT GGAGAATTTC AGGTAAAACT TCACCCTTCA
CACTCTGTTC TTCTCCTGCG TTCTTTTTTG GGTTCAATAT CCTATCTTAA TGAAATTTGG TCGGCCTAAT CCTTCCGTCG
ACCCAGCAAT TTTTGGGTTC AATATCTACT CATTGATGAA TTGACAACCG TCACTTAATG ATCTGGGCAA GAGCACCAGA
TTCAGGCTAT TTACCCTTGT AAAGTTTTCT ATTTACCCTT GTAAAGTTTT CTTATACAAC AAGAGGGTTC ACTTGAGAAT
GTATTTTGCT GCAGTGCTAC GACAGATACT TACAGAAAAG TTTAAGAAGA GCTGCAGAAG CACGAGGACA TACCATATGG
GCAAGAGCGC CAGACAGTGC AGGCCATTAT AATTCTGAGC CAAATCTGAC TGGATTTTTC TCTGACGGAG GAGATTATGA
TAGCTACTAT GGTCGTTTTT TCCTCAATTG GTATTCCCAG GTGTTGGTGG ATCATGCTGA CCGTGTATTG ATGTTAGCCA
GGTTGGCTTT TGAAGGTTCA GATATTGCTG TTAAGGTCAG TTAACTTCTT GTTGTTAATG AATGAAGTGC ACAACTGTTT
TCAGTATTTG ACCATTCTTC TGGGGGCACG TATCCCTGTT TCCAGCATCC TAATCCTATA GGTTTGACAT CAAGCTTGGT
TTACACTTTG TGGTATGACA GGTTTCAGGT GTACACTGGT GGTACAAAAC TGCCAGTCAT GCTGCTGAAT TGACTGCTGG
GTTTTATAAC CCATGCAACC GTGATGGTTA TGCCTCAATT GCTGCTGTCC TGAAAAAACA TGGTGCAGCT TTGAACTTTA
CATGTGTTGA ACTGCGCACT ATGGATCAGC ATGAGGTATT TCCTGAGGCC TTTGCAGATC CAGAGGGCCT TGTATGGCAG
GTAGGGAACT TTCCATCATC CTAGCCATGG TTGCTGTTTT GCTTTCTCAT CTACCTGGTA GCAGCTTAGT AGGCTAATGT
ATTTTTTTTC TGTTTAGCTG AGACCAGCTA TCTTGTTGTT ATGTCAATGC CTTATCAATT GGACGTATCG ATTTTCAGGT
GCTAAATGCT GCATGGGATG CTGGCATACC AGTAGCTAGT GAGAATGCTC TGCCTTGCTA CGATAGAGAT GGCTTTAACA
AAATTTTGGA GAATGCAAAG CCACTGAATG ATCCAGATGG GAGGCATTTA CTAGGATTCA CGTACCTGAG GCTCACCAAA
GTCCTCTTCG AGAGAGCTAA TTTTTTGGAA TTTGAGCGTT TCGTTAAGAG AATGCATGGT AAGGCTTAGC AGACCATGTT
TACTGACAGT GGTTCCACCT GACGTAAACC TCAGACTTAT GAATCTTGTC ATGTTTGTTT GCAGGTGAAG CAGTTCTCGA
TCTACAGGTA TAAGTTGTGT TCAGGGTTCT TACATACATA CATATATATA CATGCCATTG TAATTGGCAT AGGCCTTATG
GCTTATGATG GGGGAACAGA GATGCCATTT TTGTTTCGTA GGTTGTTGTA GTATACCATC AGCAGATTTT TGAACTATAG
AGGGTTTGGC TCCATGGTGT AAAGCATACC CTTGGCAAAG AGTTGTCATG CAGAAAATTG ATGGTTTCAT TCGGAATGAG
GTTGGAAGCA GGTGTATTTC TTTCGATGCG GCAGACATAT TTGATTTGTC ATGAGATGAG GATTGGGTGA GCAGGTGGTA
TCCTTCTGAA AGATTTGAGG CTGTATTGAA GAGAATGTGC TGATGCATGT TTATCATGGA GCAAGCGACA TTAATGGAGT
TAGCAAAGGT TCTCGCGGTG TATGTGTTTG TATTTGTTGG TGGAATGTCA CTCGAGGATC TTGGCTGTAT ACAATACATA
CATGTGCTTT TTTTTGGGTC TTTTCTACAG TGTATGAGAA ATGCATGTTT CTTACTG