Os10t0356000-00

Locus

Os10g0356000

Description

Similar to ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit.

Transcript Evidence

ab initio prediction

Protein Evidence

NP_039391.1 (RefSeq)

CGSNL Gene Symbol

CGSNL Gene Name

CGSNL Gene Symbol Synonym(s)

CGSNL Gene Name Synonym(s)

Literature (PMID)

Manual Curation

Note

GO

Biological Process: carbon fixation (GO:0015977)

Cellular Component: plastid (GO:0009536)

Molecular Function: magnesium ion binding (GO:0000287)

Molecular Function: ribulose-bisphosphate carboxylase activity (GO:0016984)

InterPro

Ribulose bisphosphate carboxylase, large subunit, C-terminal (IPR000685)

Ribulose bisphosphate carboxylase, large subunit, ferrodoxin-like N-terminal (IPR017443)

Ribulose bisphosphate carboxylase, large subunit, N-terminal (IPR017444)

Ribulose bisphosphate carboxylase, large chain, active site (IPR020878)

Transcript

1434 bp

>Os10t0356000-00 Similar to ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit.
ATGTCACCACAAACAGAAACTAAAGCAAGTGTTGGATTTAAAGCTGGTGTTAAGGATTAT
AAATTGACTTACTACACCCCGGAGTACGAAACCAAGGACACTGATATCTTGGCAGCATTC
CGAGTAACTCCTCAGCCGGGGGTTCCGCCCGAAGAAGCAGGGGCTGCAGTAGCTGCCGAA
TCTTCTACTGGTACATGGACAACTGTTTGGACTGATGGACTTACCAGTCTTGATCGTTAC
AAAGGCCGATGCTATCACATCGAGCCCGTTGTTGGGGAGGATAATCAATATATCGCTTAT
GTAGCTTATCCATTAGACCTATTTGAAGAGGGTTCTGTTACTAACATGTTTACTTCCATT
GTGGGTAACGTATTTGGTTTCAAAGCCCTACGCGCTCTACTTCTGGAGGATCTGCGAATT
CCCCCTACTTATTCAAAAACTTTCCAAGGTCCGCCTCATGGTATCCAAGTTGAAAGGGAT
AAGTTGAACAAATACGGTCGTCCTTTATTGGGATGTACTATTAAACCAAAATTGGGATTA
TCTGCAAAAAATTATGGTAGAGCATGTTATGAGTGTCTACGCGGTGGACTTGATTTTACC
AAAGATGATGAAAACGTAAACTCACAACCATTTATGCGTTGGAGGGACCGTTTTGTCTTT
TGTGCCAAAGCTATTTATAAATCACAGGCCGAAACCGGTGAAATTAAGGGGCATTACTTG
AATGCGACTGCAGGTACATGCGAAGAAATGATTAAAAGAGCTGTATTTGCGAGGGAATTA
GGGGTTCCTATTGTAATGCATGACTACTTAACCGGGGGATTCACCGCAAATACTAGTTTG
GCTCATTATTGCCGCGACAACGGCCTACTTCTTCACATTCACCGAGCAATGCATGCAGTT
ATTGATAGACAGAAAAATCATGGTATGCATTTCCGTGTATTAGCTAAAGCATTGCGTATG
TCTGGGGGAGATCATATCCACGCTGGTACAGTAGTAGGTAAGTTAGAAGGGGAACGCGAA
ATGACTTTAGGTTTTGTTGATTTATTGCGCGATGATTTTATTGAAAAAGATCGTGCTCGC
GGTATCTTTTTCACTCAGGACTGGGTATCCATGCCAGGTGTTATACCGGTGGCTTCAGGG
GGTATTCATGTTTGGCATATGCCAGCTCTGACCGAAATCTTTGGAGATGATTCTGTATTG
CAATTTGGTGGAGGAACTTTAGGACATCCTTGGGGTAATGCACCTGGTGCAGCAGCTAAT
CGGGTGGCTTTAGAAGCCTGTGTACAAGCTCGTAACGAAGGGCGCGATCTTGCTCGTGAA
GGTAATGAAATTATCCGATCAGCTTGCAAATGGAGTCGTGAACTAGCCGCAGCTTGTGAA
ATATGGAAAGCGATCAAATTCGAGTTCGAGCCGGTAGATAAACTAGATAGCTAG

CDS

1434 bp

>Os10t0356000-00 Similar to ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit.
ATGTCACCACAAACAGAAACTAAAGCAAGTGTTGGATTTAAAGCTGGTGTTAAGGATTAT
AAATTGACTTACTACACCCCGGAGTACGAAACCAAGGACACTGATATCTTGGCAGCATTC
CGAGTAACTCCTCAGCCGGGGGTTCCGCCCGAAGAAGCAGGGGCTGCAGTAGCTGCCGAA
TCTTCTACTGGTACATGGACAACTGTTTGGACTGATGGACTTACCAGTCTTGATCGTTAC
AAAGGCCGATGCTATCACATCGAGCCCGTTGTTGGGGAGGATAATCAATATATCGCTTAT
GTAGCTTATCCATTAGACCTATTTGAAGAGGGTTCTGTTACTAACATGTTTACTTCCATT
GTGGGTAACGTATTTGGTTTCAAAGCCCTACGCGCTCTACTTCTGGAGGATCTGCGAATT
CCCCCTACTTATTCAAAAACTTTCCAAGGTCCGCCTCATGGTATCCAAGTTGAAAGGGAT
AAGTTGAACAAATACGGTCGTCCTTTATTGGGATGTACTATTAAACCAAAATTGGGATTA
TCTGCAAAAAATTATGGTAGAGCATGTTATGAGTGTCTACGCGGTGGACTTGATTTTACC
AAAGATGATGAAAACGTAAACTCACAACCATTTATGCGTTGGAGGGACCGTTTTGTCTTT
TGTGCCAAAGCTATTTATAAATCACAGGCCGAAACCGGTGAAATTAAGGGGCATTACTTG
AATGCGACTGCAGGTACATGCGAAGAAATGATTAAAAGAGCTGTATTTGCGAGGGAATTA
GGGGTTCCTATTGTAATGCATGACTACTTAACCGGGGGATTCACCGCAAATACTAGTTTG
GCTCATTATTGCCGCGACAACGGCCTACTTCTTCACATTCACCGAGCAATGCATGCAGTT
ATTGATAGACAGAAAAATCATGGTATGCATTTCCGTGTATTAGCTAAAGCATTGCGTATG
TCTGGGGGAGATCATATCCACGCTGGTACAGTAGTAGGTAAGTTAGAAGGGGAACGCGAA
ATGACTTTAGGTTTTGTTGATTTATTGCGCGATGATTTTATTGAAAAAGATCGTGCTCGC
GGTATCTTTTTCACTCAGGACTGGGTATCCATGCCAGGTGTTATACCGGTGGCTTCAGGG
GGTATTCATGTTTGGCATATGCCAGCTCTGACCGAAATCTTTGGAGATGATTCTGTATTG
CAATTTGGTGGAGGAACTTTAGGACATCCTTGGGGTAATGCACCTGGTGCAGCAGCTAAT
CGGGTGGCTTTAGAAGCCTGTGTACAAGCTCGTAACGAAGGGCGCGATCTTGCTCGTGAA
GGTAATGAAATTATCCGATCAGCTTGCAAATGGAGTCGTGAACTAGCCGCAGCTTGTGAA
ATATGGAAAGCGATCAAATTCGAGTTCGAGCCGGTAGATAAACTAGATAGCTAG

Protein

478 aa

>Os10t0356000-00 Similar to ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit.
MSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEDNQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALLLEDLRIPPTYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFCAKAIYKSQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREMTLGFVDLLRDDFIEKDRAR
GIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAAAN
RVALEACVQARNEGRDLAREGNEIIRSACKWSRELAAACEIWKAIKFEFEPVDKLDS*

CDS

chr10:10861205..10862638 (+ strand) : 1434 bp

FASTA

>Os10t0356000-00 class=Sequence position=chr10:10861205..10862638 (+ strand)
ATGTCACCAC AAACAGAAAC TAAAGCAAGT GTTGGATTTA AAGCTGGTGT TAAGGATTAT AAATTGACTT ACTACACCCC
GGAGTACGAA ACCAAGGACA CTGATATCTT GGCAGCATTC CGAGTAACTC CTCAGCCGGG GGTTCCGCCC GAAGAAGCAG
GGGCTGCAGT AGCTGCCGAA TCTTCTACTG GTACATGGAC AACTGTTTGG ACTGATGGAC TTACCAGTCT TGATCGTTAC
AAAGGCCGAT GCTATCACAT CGAGCCCGTT GTTGGGGAGG ATAATCAATA TATCGCTTAT GTAGCTTATC CATTAGACCT
ATTTGAAGAG GGTTCTGTTA CTAACATGTT TACTTCCATT GTGGGTAACG TATTTGGTTT CAAAGCCCTA CGCGCTCTAC
TTCTGGAGGA TCTGCGAATT CCCCCTACTT ATTCAAAAAC TTTCCAAGGT CCGCCTCATG GTATCCAAGT TGAAAGGGAT
AAGTTGAACA AATACGGTCG TCCTTTATTG GGATGTACTA TTAAACCAAA ATTGGGATTA TCTGCAAAAA ATTATGGTAG
AGCATGTTAT GAGTGTCTAC GCGGTGGACT TGATTTTACC AAAGATGATG AAAACGTAAA CTCACAACCA TTTATGCGTT
GGAGGGACCG TTTTGTCTTT TGTGCCAAAG CTATTTATAA ATCACAGGCC GAAACCGGTG AAATTAAGGG GCATTACTTG
AATGCGACTG CAGGTACATG CGAAGAAATG ATTAAAAGAG CTGTATTTGC GAGGGAATTA GGGGTTCCTA TTGTAATGCA
TGACTACTTA ACCGGGGGAT TCACCGCAAA TACTAGTTTG GCTCATTATT GCCGCGACAA CGGCCTACTT CTTCACATTC
ACCGAGCAAT GCATGCAGTT ATTGATAGAC AGAAAAATCA TGGTATGCAT TTCCGTGTAT TAGCTAAAGC ATTGCGTATG
TCTGGGGGAG ATCATATCCA CGCTGGTACA GTAGTAGGTA AGTTAGAAGG GGAACGCGAA ATGACTTTAG GTTTTGTTGA
TTTATTGCGC GATGATTTTA TTGAAAAAGA TCGTGCTCGC GGTATCTTTT TCACTCAGGA CTGGGTATCC ATGCCAGGTG
TTATACCGGT GGCTTCAGGG GGTATTCATG TTTGGCATAT GCCAGCTCTG ACCGAAATCT TTGGAGATGA TTCTGTATTG
CAATTTGGTG GAGGAACTTT AGGACATCCT TGGGGTAATG CACCTGGTGC AGCAGCTAAT CGGGTGGCTT TAGAAGCCTG
TGTACAAGCT CGTAACGAAG GGCGCGATCT TGCTCGTGAA GGTAATGAAA TTATCCGATC AGCTTGCAAA TGGAGTCGTG
AACTAGCCGC AGCTTGTGAA ATATGGAAAG CGATCAAATT CGAGTTCGAG CCGGTAGATA AACTAGATAG CTAG