Os12t0274700-01

Locus

Os12g0274700

Description

Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).

Transcript Evidence

AK121444 (DDBJ, Best hit)

Protein Evidence

Q0INY7 (UniProt)

CGSNL Gene Symbol

RBCS

CGSNL Gene Name

RUBISCO SMALL SUBUNIT

CGSNL Gene Symbol Synonym(s)

rbcS, RBCS-C, RbcS2, OsRBCS2, RbcS1, OsRbcS2

CGSNL Gene Name Synonym(s)

Small subunits of Rubisco, "Ribulose bisphosphate carboxylase small chain, chloroplastic", RuBisCO small subunit, Ribulose bisphosphate carboxylase small chain C, RuBisCO small subunit C, RuBisCO small subunit 2, ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, Ribulose-1,5-Bisphosphate Carboxylase/Oxygenase Small Subunit 2, small subunit of ribulose-1,5-bisphosphate carboxylase

Literature (PMID)

Manual Curation

Note

InterPro

Ribulose bisphosphate carboxylase small chain, domain (IPR000894)

Ribulose-1,5-bisphosphate carboxylase small subunit, N-terminal (IPR024680)

Ribulose bisphosphate carboxylase, small chain (IPR024681)

KOME

J023141B14 (Online Clone Ordering)

Oryzabase

6394

Plant Gene Family Database (PGFD)

Os12t0274700-01

Integrative Database of Cereal Gene Phylogeny (IDCGP)

Os12t0274700-01

Transcript

981 bp

>Os12t0274700-01 Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).
GCGTGAGCCAGCCACAAACGCCCGCGGATAGGCGCGCGCACGCCGGCCAATCCTACCACA
TCCCCGGCCTCCGCGGCTCGCGAGCGCCGCTGCCATCCGATCCGCTGAGTTTTGGCTATT
TATACGTACCGCGGGAGCCTGTGTGCAGAGCAGTGCATCTCAAGAAGTACTCGAGCAAAG
AAGGAGAGAGCTTGGTGAGCTGCAGAGATGGCCCCCTCCGTGATGGCGTCGTCGGCCACC
ACCGTCGCTCCCTTCCAGGGGCTCAAGTCCACCGCCGGCATGCCCGTCGCCCGCCGCTCC
GGCAACTCCAGCTTCGGCAACGTCAGCAATGGCGGCAGGATCAGGTGCATGCAGGTGTGG
CCGATTGAGGGCATCAAGAAGTTCGAGACCCTCTCCTACCTGCCACCGCTCACCGTGGAG
GACCTCCTGAAGCAGATCGAGTACCTGCTCCGTTCCAAGTGGGTGCCCTGCCTCGAGTTC
AGCAAGGTCGGATTCGTCTACCGTGAGAACCACAGATCCCCCGGATACTACGATGGCAGG
TACTGGACCATGTGGAAGCTGCCCATGTTCGGGTGCACTGACGCCACCCAGGTGCTCAAG
GAGCTCGAGGAGGCCAAGAAGGCGTACCCTGATGCATTCGTCCGTATCATCGGCTTCGAC
AACGTCAGGCAGGTGCAGCTCATCAGCTTCATCGCCTACAAGCCCCCGGGCTGCGAGGAG
TCTGGTGGCAACTAAGCCGTCATCGTCATATATAGCCTTGTTTAATTGTTCATCTCTGAT
TCGATGATGTCTCCCACCTTGTTTCGTGTGTTCCCAGTTTGTTCATCGTCTTTTGATTTT
ACCGGCCGTGCTCTGCTTTTGTTTTTGTTTCACCTGATCTCTCTCTGACTTGATGTAAGA
GTGGTATCTGCTACGACTATATGTTGTTGGGTGAGGCATATGTGAATGAAATATATGGAA
GCTCCGGCTATATATATTTAT

CDS

528 bp

>Os12t0274700-01 Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).
ATGGCCCCCTCCGTGATGGCGTCGTCGGCCACCACCGTCGCTCCCTTCCAGGGGCTCAAG
TCCACCGCCGGCATGCCCGTCGCCCGCCGCTCCGGCAACTCCAGCTTCGGCAACGTCAGC
AATGGCGGCAGGATCAGGTGCATGCAGGTGTGGCCGATTGAGGGCATCAAGAAGTTCGAG
ACCCTCTCCTACCTGCCACCGCTCACCGTGGAGGACCTCCTGAAGCAGATCGAGTACCTG
CTCCGTTCCAAGTGGGTGCCCTGCCTCGAGTTCAGCAAGGTCGGATTCGTCTACCGTGAG
AACCACAGATCCCCCGGATACTACGATGGCAGGTACTGGACCATGTGGAAGCTGCCCATG
TTCGGGTGCACTGACGCCACCCAGGTGCTCAAGGAGCTCGAGGAGGCCAAGAAGGCGTAC
CCTGATGCATTCGTCCGTATCATCGGCTTCGACAACGTCAGGCAGGTGCAGCTCATCAGC
TTCATCGCCTACAAGCCCCCGGGCTGCGAGGAGTCTGGTGGCAACTAA

Protein

176 aa

>Os12t0274700-01 Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).
MAPSVMASSATTVAPFQGLKSTAGMPVARRSGNSSFGNVSNGGRIRCMQVWPIEGIKKFE
TLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPM
FGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESGGN*

5'UTR

chr12:10081382..10081588 (- strand) : 207 bp

CDS

chr12:10081235..10081381 (- strand) : 147 bp

chr12:10080751..10081131 (- strand) : 381 bp

3'UTR

chr12:10080505..10080750 (- strand) : 246 bp

FASTA

>Os12t0274700-01 class=Sequence position=chr12:10080505..10081588 (- strand)
GCGTGAGCCA GCCACAAACG CCCGCGGATA GGCGCGCGCA CGCCGGCCAA TCCTACCACA TCCCCGGCCT CCGCGGCTCG
CGAGCGCCGC TGCCATCCGA TCCGCTGAGT TTTGGCTATT TATACGTACC GCGGGAGCCT GTGTGCAGAG CAGTGCATCT
CAAGAAGTAC TCGAGCAAAG AAGGAGAGAG CTTGGTGAGC TGCAGAGATG GCCCCCTCCG TGATGGCGTC GTCGGCCACC
ACCGTCGCTC CCTTCCAGGG GCTCAAGTCC ACCGCCGGCA TGCCCGTCGC CCGCCGCTCC GGCAACTCCA GCTTCGGCAA
CGTCAGCAAT GGCGGCAGGA TCAGGTGCAT GCAGGTAATA ACCTACTGAC CCAACACACA TTATTCTTCT TCTTCTTCTT
CTTCTTCTTC TTCTTCTTCT TCAACATTAA CCAATAATTC AATTATCGTT TATTTAGGTG TGGCCGATTG AGGGCATCAA
GAAGTTCGAG ACCCTCTCCT ACCTGCCACC GCTCACCGTG GAGGACCTCC TGAAGCAGAT CGAGTACCTG CTCCGTTCCA
AGTGGGTGCC CTGCCTCGAG TTCAGCAAGG TCGGATTCGT CTACCGTGAG AACCACAGAT CCCCCGGATA CTACGATGGC
AGGTACTGGA CCATGTGGAA GCTGCCCATG TTCGGGTGCA CTGACGCCAC CCAGGTGCTC AAGGAGCTCG AGGAGGCCAA
GAAGGCGTAC CCTGATGCAT TCGTCCGTAT CATCGGCTTC GACAACGTCA GGCAGGTGCA GCTCATCAGC TTCATCGCCT
ACAAGCCCCC GGGCTGCGAG GAGTCTGGTG GCAACTAAGC CGTCATCGTC ATATATAGCC TTGTTTAATT GTTCATCTCT
GATTCGATGA TGTCTCCCAC CTTGTTTCGT GTGTTCCCAG TTTGTTCATC GTCTTTTGAT TTTACCGGCC GTGCTCTGCT
TTTGTTTTTG TTTCACCTGA TCTCTCTCTG ACTTGATGTA AGAGTGGTAT CTGCTACGAC TATATGTTGT TGGGTGAGGC
ATATGTGAAT GAAATATATG GAAGCTCCGG CTATATATAT TTAT