Os12t0291100-01

Locus

Os12g0291100

Description

Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).

Transcript Evidence

AK068555 (DDBJ, Best hit)

Protein Evidence

A6N0B6 (UniProt)

CGSNL Gene Symbol

_

CGSNL Gene Name

_

CGSNL Gene Symbol Synonym(s)

RbcS3, OsRBCS3, OsRbcS3

CGSNL Gene Name Synonym(s)

RuBisCO small subunit 3, Ribulose-1,5-Bisphosphate Carboxylase/Oxygenase Small Subunit 3

Literature (PMID)

Manual Curation

Note

InterPro

Ribulose bisphosphate carboxylase small chain, domain (IPR000894)

Ribulose-1,5-bisphosphate carboxylase small subunit, N-terminal (IPR024680)

Ribulose bisphosphate carboxylase, small chain (IPR024681)

KEGG

Os12t0291100-01 (EC:4.1.1.39)

KOME

J013156H12 (Online Clone Ordering)

RiceXPro Database

AK068555

Oryzabase

12043

Plant Gene Family Database (PGFD)

Os12t0291100-01

Transcript

896 bp

>Os12t0291100-01 Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).
AACAGCACTGCTACTGGACATACTCTACTACTACTAGCCAGTAAGCTAGCTAACTAACTA
CGTGGCTATGGCCCCCACCGTGATGGCCTCCTCGGCCACCTCCGTGGCTCCATTCCAAGG
GCTCAAGTCCACCGCCGGGCTCCCCGTCAGCCGCCGCTCCACCAACTCGGGCTTCGGCAA
CGTCAGCAATGGCGGAAGGATCAAGTGCATGCAGGTGTGGCCAATTGAGGGCATCAAGAA
GTTCGAGACCCTATCGTACCTGCCACCACTCACCGTGGAGGATCTTTTGAAGCAGATCGA
GTACCTGCTTCGATCCAAGTGGGTGCCTTGCCTCGAGTTCAGCAAGGTTGGATTCGTCTA
CCGTGAGAACCACAGGTCTCCCGGGTACTACGATGGCAGGTATTGGACCATGTGGAAGCT
GCCCATGTTCGGCTGCACCGATGCCACCCAGGTGCTCAAGGAGCTCGAGGAGGCCAAGAA
GGCCTACCCCGATGCCTTTGTCCGTATCATCGGCTTCGACAACGTCAGGCAGGTGCAGTT
GATTAGCTTCATCGCCTACAAGCCCCCAGGTTGCGAGGAGTCTGGTGGCAACTAAGCTAA
GATCAAGCATCGCGCTGGTGGATTGCTGCCTATAATAATAGTATGCAGCTTTGTTTTGGG
CTATGTTGATGATATATCAATATATAATATGCTATATATTTTTATTTTACAGTTTGGTTA
TGTACCATCTCAATGGCCTCTGCTCTTAACACATATGTAATAATCTCTTCCCTCCCTCTC
CGGCCGGTTTTATTGTAAGAGTACTACAATTATCGTTGGGTGAGGATATGTGAAAACAAA
GCTCCGGCTATATACACACAAGATATGTATCTAGAGCATATCTGATAAATTCGTCG

CDS

528 bp

>Os12t0291100-01 Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).
ATGGCCCCCACCGTGATGGCCTCCTCGGCCACCTCCGTGGCTCCATTCCAAGGGCTCAAG
TCCACCGCCGGGCTCCCCGTCAGCCGCCGCTCCACCAACTCGGGCTTCGGCAACGTCAGC
AATGGCGGAAGGATCAAGTGCATGCAGGTGTGGCCAATTGAGGGCATCAAGAAGTTCGAG
ACCCTATCGTACCTGCCACCACTCACCGTGGAGGATCTTTTGAAGCAGATCGAGTACCTG
CTTCGATCCAAGTGGGTGCCTTGCCTCGAGTTCAGCAAGGTTGGATTCGTCTACCGTGAG
AACCACAGGTCTCCCGGGTACTACGATGGCAGGTATTGGACCATGTGGAAGCTGCCCATG
TTCGGCTGCACCGATGCCACCCAGGTGCTCAAGGAGCTCGAGGAGGCCAAGAAGGCCTAC
CCCGATGCCTTTGTCCGTATCATCGGCTTCGACAACGTCAGGCAGGTGCAGTTGATTAGC
TTCATCGCCTACAAGCCCCCAGGTTGCGAGGAGTCTGGTGGCAACTAA

Protein

176 aa

>Os12t0291100-01 Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).
MAPTVMASSATSVAPFQGLKSTAGLPVSRRSTNSGFGNVSNGGRIKCMQVWPIEGIKKFE
TLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPM
FGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESGGN*

5'UTR

chr12:11262587..11262653 (+ strand) : 67 bp

CDS

chr12:11262654..11262800 (+ strand) : 147 bp

chr12:11262912..11263292 (+ strand) : 381 bp

3'UTR

chr12:11263293..11263593 (+ strand) : 301 bp

FASTA

>Os12t0291100-01 class=Sequence position=chr12:11262587..11263593 (+ strand)
AACAGCACTG CTACTGGACA TACTCTACTA CTACTAGCCA GTAAGCTAGC TAACTAACTA CGTGGCTATG GCCCCCACCG
TGATGGCCTC CTCGGCCACC TCCGTGGCTC CATTCCAAGG GCTCAAGTCC ACCGCCGGGC TCCCCGTCAG CCGCCGCTCC
ACCAACTCGG GCTTCGGCAA CGTCAGCAAT GGCGGAAGGA TCAAGTGCAT GCAGGTATAT ATGATATATA CCTCCTCAGG
CTTCTCCTTT AAAGTCAAGG ATCAAATTAA CTCATGTTAC GAAATTCAAA TTAACCTGAT TTAAATTTTT ACATTATTTA
TTCAGGTGTG GCCAATTGAG GGCATCAAGA AGTTCGAGAC CCTATCGTAC CTGCCACCAC TCACCGTGGA GGATCTTTTG
AAGCAGATCG AGTACCTGCT TCGATCCAAG TGGGTGCCTT GCCTCGAGTT CAGCAAGGTT GGATTCGTCT ACCGTGAGAA
CCACAGGTCT CCCGGGTACT ACGATGGCAG GTATTGGACC ATGTGGAAGC TGCCCATGTT CGGCTGCACC GATGCCACCC
AGGTGCTCAA GGAGCTCGAG GAGGCCAAGA AGGCCTACCC CGATGCCTTT GTCCGTATCA TCGGCTTCGA CAACGTCAGG
CAGGTGCAGT TGATTAGCTT CATCGCCTAC AAGCCCCCAG GTTGCGAGGA GTCTGGTGGC AACTAAGCTA AGATCAAGCA
TCGCGCTGGT GGATTGCTGC CTATAATAAT AGTATGCAGC TTTGTTTTGG GCTATGTTGA TGATATATCA ATATATAATA
TGCTATATAT TTTTATTTTA CAGTTTGGTT ATGTACCATC TCAATGGCCT CTGCTCTTAA CACATATGTA ATAATCTCTT
CCCTCCCTCT CCGGCCGGTT TTATTGTAAG AGTACTACAA TTATCGTTGG GTGAGGATAT GTGAAAACAA AGCTCCGGCT
ATATACACAC AAGATATGTA TCTAGAGCAT ATCTGATAAA TTCGTCG