Os12t0291400-01

Locus

Os12g0291400

Description

Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).

Transcript Evidence

AK099574 (DDBJ, Best hit)

Protein Evidence

A6N0B6 (UniProt)

CGSNL Gene Symbol

_

CGSNL Gene Name

_

CGSNL Gene Symbol Synonym(s)

RbcS5, OsRBCS5

CGSNL Gene Name Synonym(s)

RuBisCO small subunit 5

Literature (PMID)

Manual Curation

Note

InterPro

Ribulose bisphosphate carboxylase small chain, domain (IPR000894)

Ribulose-1,5-bisphosphate carboxylase small subunit, N-terminal (IPR024680)

Ribulose bisphosphate carboxylase, small chain (IPR024681)

KEGG

Os12t0291400-01 (EC:4.1.1.39)

KOME

J013036G21 (Online Clone Ordering)

RiceXPro Database

AK099574

Oryzabase

12044

Plant Gene Family Database (PGFD)

Os12t0291400-01

Transcript

943 bp

>Os12t0291400-01 Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).
AAGCCACTGCTGCAGCGTGACTCTGCTCTAGCACCTCACCAAGCAGAAAGCTAGAGAGCT
AGCAATGGCGCCCACCGTGATGGCCTCGTCGGCCACCTCCGTTGCTCCCTTCCAGGGGCT
CAAATCCACCGCCGGGCTCCCCGTCAGCCGCCGCTCCAACAGCGCCGGCCTCGGCAGCGT
CAGCAACGGTGGAAGGATCAGCTGTATGCAGGTGTGGCCGATTGAAGGCATCAAGAAGTT
TGAGACCCTGTCGTACCTGCCACCGCTCACGGTCGAGGACCTCTTGAAGCAGATCGAGTA
CCTGCTCCGGTCCAAATGGGTGCCTTGCCTCGAGTTTAGTAAGGTCGGGTTCGTCTACCG
TGAGAACCACAGGTCTCCTGGGTACTATGATGGCAGGTACTGGACCATGTGGAAGCTGCC
TATGTTCGGATGCACTGATGCCACCCAGGTGCTCAAGGAGCTCGAGGAGGCCAAGAAGGC
ATATCCAGATGCATTTGTTCGCATCATCGGCTTCGACAACGTCAGGCAGGTGCAGTTGAT
TAGCTTCATCGCCTACAAGCCCCCGGGTTGCGAGGAGTCCGGCGGAAACTAAGCTAGTTG
GCAAGCCAGCAAGCTCACTCGTGAGCTCTATACAGAGGAGACTCGATTGATCTATTCGGT
TTTGGCAGCTTTGAACGTTCGAATCGGGCCACCTTGCATTGGTTTCCCCTTTCCCAGTTT
GTTGCTTCAGTTTTTTTTTTTCATCTTGTTTGTGTCAACATCAGCTGTGTATGTATGTAC
ATATGTATGTATCAACATAGGTTGAAGAGCATGCATATGTGAATGCTAGCACCAGGCTAA
TCATATGCACATACACATCGTAATAAATATATTGTACAAATCGTCAAAAACGATACTTAT
ATGTAATACTATACTCAGACCAAACTTGATACCTCTGGTTTCC

CDS

528 bp

>Os12t0291400-01 Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).
ATGGCGCCCACCGTGATGGCCTCGTCGGCCACCTCCGTTGCTCCCTTCCAGGGGCTCAAA
TCCACCGCCGGGCTCCCCGTCAGCCGCCGCTCCAACAGCGCCGGCCTCGGCAGCGTCAGC
AACGGTGGAAGGATCAGCTGTATGCAGGTGTGGCCGATTGAAGGCATCAAGAAGTTTGAG
ACCCTGTCGTACCTGCCACCGCTCACGGTCGAGGACCTCTTGAAGCAGATCGAGTACCTG
CTCCGGTCCAAATGGGTGCCTTGCCTCGAGTTTAGTAAGGTCGGGTTCGTCTACCGTGAG
AACCACAGGTCTCCTGGGTACTATGATGGCAGGTACTGGACCATGTGGAAGCTGCCTATG
TTCGGATGCACTGATGCCACCCAGGTGCTCAAGGAGCTCGAGGAGGCCAAGAAGGCATAT
CCAGATGCATTTGTTCGCATCATCGGCTTCGACAACGTCAGGCAGGTGCAGTTGATTAGC
TTCATCGCCTACAAGCCCCCGGGTTGCGAGGAGTCCGGCGGAAACTAA

Protein

176 aa

>Os12t0291400-01 Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).
MAPTVMASSATSVAPFQGLKSTAGLPVSRRSNSAGLGSVSNGGRISCMQVWPIEGIKKFE
TLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPM
FGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESGGN*

5'UTR

chr12:11277247..11277310 (+ strand) : 64 bp

CDS

chr12:11277311..11277457 (+ strand) : 147 bp

chr12:11277575..11277955 (+ strand) : 381 bp

3'UTR

chr12:11277956..11278306 (+ strand) : 351 bp

FASTA

>Os12t0291400-01 class=Sequence position=chr12:11277247..11278306 (+ strand)
AAGCCACTGC TGCAGCGTGA CTCTGCTCTA GCACCTCACC AAGCAGAAAG CTAGAGAGCT AGCAATGGCG CCCACCGTGA
TGGCCTCGTC GGCCACCTCC GTTGCTCCCT TCCAGGGGCT CAAATCCACC GCCGGGCTCC CCGTCAGCCG CCGCTCCAAC
AGCGCCGGCC TCGGCAGCGT CAGCAACGGT GGAAGGATCA GCTGTATGCA GGTATGAACA AGCCAACATA GGATCAGTAC
AAGCTTAATT GGTATCTTCA TCCTCATCAC ACACACAGGA AATTAAAGAG AGCTCATCAA CTTTAACCCA TATGATTTCT
CTGCGCAGGT GTGGCCGATT GAAGGCATCA AGAAGTTTGA GACCCTGTCG TACCTGCCAC CGCTCACGGT CGAGGACCTC
TTGAAGCAGA TCGAGTACCT GCTCCGGTCC AAATGGGTGC CTTGCCTCGA GTTTAGTAAG GTCGGGTTCG TCTACCGTGA
GAACCACAGG TCTCCTGGGT ACTATGATGG CAGGTACTGG ACCATGTGGA AGCTGCCTAT GTTCGGATGC ACTGATGCCA
CCCAGGTGCT CAAGGAGCTC GAGGAGGCCA AGAAGGCATA TCCAGATGCA TTTGTTCGCA TCATCGGCTT CGACAACGTC
AGGCAGGTGC AGTTGATTAG CTTCATCGCC TACAAGCCCC CGGGTTGCGA GGAGTCCGGC GGAAACTAAG CTAGTTGGCA
AGCCAGCAAG CTCACTCGTG AGCTCTATAC AGAGGAGACT CGATTGATCT ATTCGGTTTT GGCAGCTTTG AACGTTCGAA
TCGGGCCACC TTGCATTGGT TTCCCCTTTC CCAGTTTGTT GCTTCAGTTT TTTTTTTTCA TCTTGTTTGT GTCAACATCA
GCTGTGTATG TATGTACATA TGTATGTATC AACATAGGTT GAAGAGCATG CATATGTGAA TGCTAGCACC AGGCTAATCA
TATGCACATA CACATCGTAA TAAATATATT GTACAAATCG TCAAAAACGA TACTTATATG TAATACTATA CTCAGACCAA
ACTTGATACC TCTGGTTTCC