Os12t0292400-01

Locus

Os12g0292400

Description

Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).

Transcript Evidence

AK068266 (DDBJ, Best hit)

AK070257 (DDBJ, Best hit)

Protein Evidence

A6MZQ8 (UniProt)

CGSNL Gene Symbol

_

CGSNL Gene Name

_

CGSNL Gene Symbol Synonym(s)

RbcS, RbcS4, OsRBCS4

CGSNL Gene Name Synonym(s)

nuclear encoded small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase, RuBisCO small subunit 4

Literature (PMID)

Manual Curation

Note

InterPro

Ribulose bisphosphate carboxylase small chain, domain (IPR000894)

Ribulose-1,5-bisphosphate carboxylase small subunit, N-terminal (IPR024680)

Ribulose bisphosphate carboxylase, small chain (IPR024681)

KOME

J013149A10 (Online Clone Ordering)

J023042N11 (Online Clone Ordering)

Oryzabase

9713

Plant Gene Family Database (PGFD)

Os12t0292400-01

Transcript

1994 bp

>Os12t0292400-01 Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).
GTACTCAAGCCGGAGGCAGCACACTGCAACTTAAGTTTTTCTATAGCTCCTAGCAAGCTA
GCAATGGCTCCCTCGGTGATGGCTTCGTCGGCCACCTCCGTGGCTCCCTTCCAGGGGCTC
AAGTCCACTGCGGGCCTCCCGGTGAACCGCCGCTCCAGCAGCTCGAGCTTTGGCAACGTC
AGCAATGGCGGAAGGATCAGATGCATGCAGGTGTGGCCGATTGAGGGCATTAAGAAGTTC
GAGACTCTGTCGTACTTGCCGCCATTGACAGTGGAGGACCTTTTGAAGCAGATCGAGTAC
CTGCTCCGATCTAAGTGGGTGCCTTGCTTGGAGTTCAGCAAGGTCGGATTCGTCTACCGT
GAGAATCACAGATCACCCGGATACTATGACGGTAGGTACTGGACCATGTGGAAACTGCCC
ATGTTTGGATGCACCGATGCCACCCAAGTGCTCAAGGAGCTCGAGGAGGCAAAGAAGGCA
TACCCTGATGCCTTCGTTCGCATCATTGGCTTTGACAACGTTAGGCAGGTGCAGTTAATC
AGCTTCATCGCGTATAAGCCACCGGGTTGCGAGGAGTCAGGCGGCAACTAAGCGCTTTCG
TTCCTTCGTGCATGTTCTTTCTTTTTCTTTTTTTTTTGTGTGTCCGTGTTAAGCTGCACG
TAATTGTTCTCTCGCGCTCCGACCTGCCGTTGTTGCAAGAGTACTACTACAACTATCGGT
CTATCGTTCGGTGACGGTGAGACAGGGCACGTGAATGCAAGATCTCCGGCTATACACACG
TACTCATGTAATATGATGCCTAGAGCATATCTGAATCCGTCGACAATGAAATTTTGGTTT
TGCAAAATGCTGGTATTTGTTTATCATCCTGGCACGTGATATTTGCCTAGAGCATCTAAA
TCACTTTTACGAAATGTGCGCGTCAACAAACTGATACGGCCCAAATGCCAGAAATTACCA
GCATATATAGCCATATCAACTTTTGATTCGTATATATGAAGGTTGATTTAGTTAGAGAAA
TTCGGTTGTGAGAGAAGGAGGCTAGCAAAGATTCGGTTGATCAAGCTGTACCGCCAGGCC
AGGACGTGCTGTGCGCGCGGCTGTGCCGCTTGACCGCAGAACCATACGGAATTGACGGAC
CAATTGTGCATACGGACTTAGCTAAAATAATTGTTGatttttggcaataagaaaagcgag
tagcacataaaatctaaagtggatgagtaaagggacaaaattttatacatgttcaggcct
tctcgatgagaagtaatactatactcctgttttggggattATATTTGTCAGATGTTGTAT
CAATCTGACGATCGAGTTATGGTTATtgttggcggctgttaaatatcgattttatgccat
caatacctgtataatttatacagaaataataaaacattcaacatagtggtaggctttaat
tctaacatattccataagtgttggtgtatatttggatgcaggtaataaaccaccgaatta
ggaggaaatctagactaagttgaaggaaattttcatccatacaagtgttgggctttttaa
ctccattttaacaccaaaatgcaagcccaaaaacctgcgaaatggataaggcagactgag
aaggaggcccaggccaaaacttgggccagttgggccaagccaggtttcggccaaatcctg
atcatcgctgttgatctcagggtttggcatggacgctcttgatttactcctgatggcagt
tgcagggcatttccgatcattcgcatgctctacaaccatcatacctacttatttaaggag
ctctcatcctcacttcatatcacacactccaatcttgagctgaattataagaggctctat
tgtattttattgtatactagaattagggaaagattaaggtcgtagaagaaatcggaggaa
ttccggagttatcggtgatccttttctatttcttatactttgttatttgctttaatagaa
atatcatttcaagt

CDS

528 bp

>Os12t0292400-01 Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).
ATGGCTCCCTCGGTGATGGCTTCGTCGGCCACCTCCGTGGCTCCCTTCCAGGGGCTCAAG
TCCACTGCGGGCCTCCCGGTGAACCGCCGCTCCAGCAGCTCGAGCTTTGGCAACGTCAGC
AATGGCGGAAGGATCAGATGCATGCAGGTGTGGCCGATTGAGGGCATTAAGAAGTTCGAG
ACTCTGTCGTACTTGCCGCCATTGACAGTGGAGGACCTTTTGAAGCAGATCGAGTACCTG
CTCCGATCTAAGTGGGTGCCTTGCTTGGAGTTCAGCAAGGTCGGATTCGTCTACCGTGAG
AATCACAGATCACCCGGATACTATGACGGTAGGTACTGGACCATGTGGAAACTGCCCATG
TTTGGATGCACCGATGCCACCCAAGTGCTCAAGGAGCTCGAGGAGGCAAAGAAGGCATAC
CCTGATGCCTTCGTTCGCATCATTGGCTTTGACAACGTTAGGCAGGTGCAGTTAATCAGC
TTCATCGCGTATAAGCCACCGGGTTGCGAGGAGTCAGGCGGCAACTAA

Protein

176 aa

>Os12t0292400-01 Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).
MAPSVMASSATSVAPFQGLKSTAGLPVNRRSSSSSFGNVSNGGRIRCMQVWPIEGIKKFE
TLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPM
FGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESGGN*

5'UTR

chr12:11320409..11320471 (+ strand) : 63 bp

CDS

chr12:11320472..11320618 (+ strand) : 147 bp

chr12:11320722..11321102 (+ strand) : 381 bp

3'UTR

chr12:11321103..11322505 (+ strand) : 1403 bp

FASTA

>Os12t0292400-01 class=Sequence position=chr12:11320409..11322505 (+ strand)
GTACTCAAGC CGGAGGCAGC ACACTGCAAC TTAAGTTTTT CTATAGCTCC TAGCAAGCTA GCAATGGCTC CCTCGGTGAT
GGCTTCGTCG GCCACCTCCG TGGCTCCCTT CCAGGGGCTC AAGTCCACTG CGGGCCTCCC GGTGAACCGC CGCTCCAGCA
GCTCGAGCTT TGGCAACGTC AGCAATGGCG GAAGGATCAG ATGCATGCAG GTATCAGAAA CGATACGTTT CAATTTCTCC
TTCAAAGTGC TCGTTGTTCA TATATATTAA ATGTTGGCCC GATTCTATTA TCTGCATCAA TTCATTCAAT CAGGTGTGGC
CGATTGAGGG CATTAAGAAG TTCGAGACTC TGTCGTACTT GCCGCCATTG ACAGTGGAGG ACCTTTTGAA GCAGATCGAG
TACCTGCTCC GATCTAAGTG GGTGCCTTGC TTGGAGTTCA GCAAGGTCGG ATTCGTCTAC CGTGAGAATC ACAGATCACC
CGGATACTAT GACGGTAGGT ACTGGACCAT GTGGAAACTG CCCATGTTTG GATGCACCGA TGCCACCCAA GTGCTCAAGG
AGCTCGAGGA GGCAAAGAAG GCATACCCTG ATGCCTTCGT TCGCATCATT GGCTTTGACA ACGTTAGGCA GGTGCAGTTA
ATCAGCTTCA TCGCGTATAA GCCACCGGGT TGCGAGGAGT CAGGCGGCAA CTAAGCGCTT TCGTTCCTTC GTGCATGTTC
TTTCTTTTTC TTTTTTTTTT GTGTGTCCGT GTTAAGCTGC ACGTAATTGT TCTCTCGCGC TCCGACCTGC CGTTGTTGCA
AGAGTACTAC TACAACTATC GGTCTATCGT TCGGTGACGG TGAGACAGGG CACGTGAATG CAAGATCTCC GGCTATACAC
ACGTACTCAT GTAATATGAT GCCTAGAGCA TATCTGAATC CGTCGACAAT GAAATTTTGG TTTTGCAAAA TGCTGGTATT
TGTTTATCAT CCTGGCACGT GATATTTGCC TAGAGCATCT AAATCACTTT TACGAAATGT GCGCGTCAAC AAACTGATAC
GGCCCAAATG CCAGAAATTA CCAGCATATA TAGCCATATC AACTTTTGAT TCGTATATAT GAAGGTTGAT TTAGTTAGAG
AAATTCGGTT GTGAGAGAAG GAGGCTAGCA AAGATTCGGT TGATCAAGCT GTACCGCCAG GCCAGGACGT GCTGTGCGCG
CGGCTGTGCC GCTTGACCGC AGAACCATAC GGAATTGACG GACCAATTGT GCATACGGAC TTAGCTAAAA TAATTGTTGa
tttttggcaa taagaaaagc gagtagcaca taaaatctaa agtggatgag taaagggaca aaattttata catgttcagg
ccttctcgat gagaagtaat actatactcc tgttttgggg attATATTTG TCAGATGTTG TATCAATCTG ACGATCGAGT
TATGGTTATt gttggcggct gttaaatatc gattttatgc catcaatacc tgtataattt atacagaaat aataaaacat
tcaacatagt ggtaggcttt aattctaaca tattccataa gtgttggtgt atatttggat gcaggtaata aaccaccgaa
ttaggaggaa atctagacta agttgaagga aattttcatc catacaagtg ttgggctttt taactccatt ttaacaccaa
aatgcaagcc caaaaacctg cgaaatggat aaggcagact gagaaggagg cccaggccaa aacttgggcc agttgggcca
agccaggttt cggccaaatc ctgatcatcg ctgttgatct cagggtttgg catggacgct cttgatttac tcctgatggc
agttgcaggg catttccgat cattcgcatg ctctacaacc atcataccta cttatttaag gagctctcat cctcacttca
tatcacacac tccaatcttg agctgaatta taagaggctc tattgtattt tattgtatac tagaattagg gaaagattaa
ggtcgtagaa gaaatcggag gaattccgga gttatcggtg atccttttct atttcttata ctttgttatt tgctttaata
gaaatatcat ttcaagt