Os12t0632700-01

Locus

Os12g0632700

Description

Malate dehydrogenase, glyoxysomal precursor (EC 1.1.1.37).

Transcript Evidence

AK065955 (DDBJ, Best hit)

AK061793 (DDBJ, Best hit)

Protein Evidence

B8BN58 (UniProt)

CGSNL Gene Symbol

_

CGSNL Gene Name

_

CGSNL Gene Symbol Synonym(s)

_

CGSNL Gene Name Synonym(s)

Glyoxysomal Malate Dehydrogenase

Literature (PMID)

Manual Curation

Note

GO

Biological Process: carbohydrate metabolic process (GO:0005975)

Biological Process: malate metabolic process (GO:0006108)

Biological Process: cellular carbohydrate metabolic process (GO:0044262)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: malate dehydrogenase activity (GO:0016615)

Molecular Function: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (GO:0016616)

Molecular Function: L-malate dehydrogenase activity (GO:0030060)

InterPro

Lactate/malate dehydrogenase, N-terminal (IPR001236)

Malate dehydrogenase, active site (IPR001252)

L-lactate/malate dehydrogenase (IPR001557)

Malate dehydrogenase, type 1 (IPR010097)

Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal (IPR015955)

NAD(P)-binding domain (IPR016040)

Lactate/malate dehydrogenase, C-terminal (IPR022383)

KEGG

Os12t0632700-01 (EC:1.1.1.37)

KOME

J013045C09 (Online Clone Ordering)

001-039-F06 (Online Clone Ordering)

RiceXPro Database

AK065955

Oryzabase

15755

Plant Gene Family Database (PGFD)

Os12t0632700-01

Transcript

1466 bp

>Os12t0632700-01 Malate dehydrogenase, glyoxysomal precursor (EC 1.1.1.37).
CGTTCCCGCGCCACCAAACCAAACCAACTCTTCGTCGTCGCGCCGCTTCCGTTCTTCCGG
CGGCCATGGAGGACGCAGCAGCAGCAGCAAGGCGGATGGAGAGGCTTGCCTCCCACCTCC
GCCCGCCCGCTTCTCAGATGGAGGAATCACCCCTCCTGAGGGGCTCCAATTGCCGGGCAA
AAGGTGCCGCTCCGGGTTTCAAGGTCGCCATCTTGGGAGCGTCTGGTGGGATTGGCCAGC
CTCTTGCATTGCTCATGAAGATGAACCCTCTTGTTTCTGTGCTCCATCTGTACGATGTTG
TCAACACTCCCGGTGTCACAGCTGACATTAGCCACATGAACACTGGTGCTGTGGTGCGTG
GTTTCTTGGGCCAGCCACAGTTGGAAAATGCCCTTACTGGAATGGATCTTGTGATCATTC
CTGCTGGTGTTCCTCGTAAGCCTGGGATGACAAGGGATGATTTGTTCAACATCAATGCCG
GAATCGTCCGGACTCTTTGTGAAGGAATCGCAAAATGCTGCCCCAATGCAATTGTGAATG
TGATCAGCAACCCTGTCAATTCTACTGTTCCGATTGCTGCTGAGGTTTTTAAGAAAGCTG
GGACATATGACCCTAAGCGCCTTTTGGGGGTGACGACACTTGATGTAGTGAGAGCCAATA
CTTTTGTGGCAGAAGTTCTTGGGCTTGACCCCAGAGATGTAAATGTCCCTGTCATTGGTG
GGCATGCAGGAGTAACAATATTACCACTCCTTTCACAGGTGAATCCTCCCTGCTCATTCA
CCTCAGAAGAAATTAGTTATCTTACCACTCGCATACAGAATGGTGGGACAGAAGTAGTCG
AGGCTAAAGCTGGAGCGGGGTCTGCAACCCTTTCAATGGCGTATGCAGCTTCTAAATTTG
CAGATGCTTGCTTGAGAGGATTGCGTGGCGACGCTGGGATAGTGGAGTGCTCTTTTGTAG
CTTCTCAGGTGACAGAGCTGCCTTTCTTTGCATCCAAAGTGCGGTTAGGTCGCTGTGGCA
TCGAGGAGATCTTATCACTTGGTCCATTGAATGAATTCGAAAGAGCTGGACTGGAGAAGG
CTAAGAAGGAGCTGGCCGAGAGTATCCAAAAGGGGGTCGCTTTCATCAACAAGTGAGGCC
ATCTTGGAATGCCCCAATTTAGTTCAACATGGAAATACACAGGCTGTGTCTTTGCTTCCT
GGGGAGTGGGAAGAACACTTGTATCATCTTGTCTCAAATGTAAAAGCTGCCTACACGATG
TTTATACAGCTGTAGCAGATGCAAAAACACAAGTCTGCTAATAAAAGTTGCTTCTGAATA
AAAAGGAACCCTGCTCTGATCTCTGCCTTGTTAATTATGTTTCCCTGGACAGTGAACATC
TCATCAGGTGTAATTTGATCTTGTGATGGACTTGCAAATTATAGAGGAAAAAGAAAAGCG
GAACTAAATTTtacttcctccgtttc

CDS

1071 bp

>Os12t0632700-01 Malate dehydrogenase, glyoxysomal precursor (EC 1.1.1.37).
ATGGAGGACGCAGCAGCAGCAGCAAGGCGGATGGAGAGGCTTGCCTCCCACCTCCGCCCG
CCCGCTTCTCAGATGGAGGAATCACCCCTCCTGAGGGGCTCCAATTGCCGGGCAAAAGGT
GCCGCTCCGGGTTTCAAGGTCGCCATCTTGGGAGCGTCTGGTGGGATTGGCCAGCCTCTT
GCATTGCTCATGAAGATGAACCCTCTTGTTTCTGTGCTCCATCTGTACGATGTTGTCAAC
ACTCCCGGTGTCACAGCTGACATTAGCCACATGAACACTGGTGCTGTGGTGCGTGGTTTC
TTGGGCCAGCCACAGTTGGAAAATGCCCTTACTGGAATGGATCTTGTGATCATTCCTGCT
GGTGTTCCTCGTAAGCCTGGGATGACAAGGGATGATTTGTTCAACATCAATGCCGGAATC
GTCCGGACTCTTTGTGAAGGAATCGCAAAATGCTGCCCCAATGCAATTGTGAATGTGATC
AGCAACCCTGTCAATTCTACTGTTCCGATTGCTGCTGAGGTTTTTAAGAAAGCTGGGACA
TATGACCCTAAGCGCCTTTTGGGGGTGACGACACTTGATGTAGTGAGAGCCAATACTTTT
GTGGCAGAAGTTCTTGGGCTTGACCCCAGAGATGTAAATGTCCCTGTCATTGGTGGGCAT
GCAGGAGTAACAATATTACCACTCCTTTCACAGGTGAATCCTCCCTGCTCATTCACCTCA
GAAGAAATTAGTTATCTTACCACTCGCATACAGAATGGTGGGACAGAAGTAGTCGAGGCT
AAAGCTGGAGCGGGGTCTGCAACCCTTTCAATGGCGTATGCAGCTTCTAAATTTGCAGAT
GCTTGCTTGAGAGGATTGCGTGGCGACGCTGGGATAGTGGAGTGCTCTTTTGTAGCTTCT
CAGGTGACAGAGCTGCCTTTCTTTGCATCCAAAGTGCGGTTAGGTCGCTGTGGCATCGAG
GAGATCTTATCACTTGGTCCATTGAATGAATTCGAAAGAGCTGGACTGGAGAAGGCTAAG
AAGGAGCTGGCCGAGAGTATCCAAAAGGGGGTCGCTTTCATCAACAAGTGA

Protein

357 aa

>Os12t0632700-01 Malate dehydrogenase, glyoxysomal precursor (EC 1.1.1.37).
MEDAAAAARRMERLASHLRPPASQMEESPLLRGSNCRAKGAAPGFKVAILGASGGIGQPL
ALLMKMNPLVSVLHLYDVVNTPGVTADISHMNTGAVVRGFLGQPQLENALTGMDLVIIPA
GVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNAIVNVISNPVNSTVPIAAEVFKKAGT
YDPKRLLGVTTLDVVRANTFVAEVLGLDPRDVNVPVIGGHAGVTILPLLSQVNPPCSFTS
EEISYLTTRIQNGGTEVVEAKAGAGSATLSMAYAASKFADACLRGLRGDAGIVECSFVAS
QVTELPFFASKVRLGRCGIEEILSLGPLNEFERAGLEKAKKELAESIQKGVAFINK*

5'UTR

chr12:27099272..27099336 (- strand) : 65 bp

CDS

chr12:27099200..27099271 (- strand) : 72 bp

chr12:27098047..27098262 (- strand) : 216 bp

chr12:27097173..27097487 (- strand) : 315 bp

chr12:27096985..27097074 (- strand) : 90 bp

chr12:27096748..27096831 (- strand) : 84 bp

chr12:27096074..27096109 (- strand) : 36 bp

chr12:27095895..27095984 (- strand) : 90 bp

chr12:27095708..27095802 (- strand) : 95 bp

chr12:27094979..27095051 (- strand) : 73 bp

3'UTR

chr12:27094649..27094978 (- strand) : 330 bp

FASTA

>Os12t0632700-01 class=Sequence position=chr12:27094649..27099336 (- strand)
CGTTCCCGCG CCACCAAACC AAACCAACTC TTCGTCGTCG CGCCGCTTCC GTTCTTCCGG CGGCCATGGA GGACGCAGCA
GCAGCAGCAA GGCGGATGGA GAGGCTTGCC TCCCACCTCC GCCCGCCCGC TTCTCAGGTC AGCACCCCAC ACGCCGCCCA
GATCCCCATC TCTCTCTCTC CCCCACCCTC TTTTTCTTTT CCACCCGATT TAATTCAGGT TTAGTTTAGT TTGGTTTGCT
GCGCGTTTGC TTTTCGGGAA GCTGCAAGAT GATCTTGCTC ATCTAGTATC CGAGGTTACC TTCTTCTTGC AAGCTTGGGG
ATTACGGGGA GTTGAGATTG GGGAGGTGGC GAGTCAACCA TGGGGATGGC TGGACCTAGG TTACTACTAC TACTATTCAG
TTACTTTTAG TTTGGATCTC CTTCTTGAAT TACCTACGCC GCGGGGTACC GATTTCACAG TGCTTCTGAT CGAATTATGT
TTTAGTTTAT CACTTGCAAT GTACTACTAG TGTAAAGCTA CCAACTTTAC TGGACTTGGA GGAGGTCCCG TTAGCTAGCT
TTGGGGGAAC CAAATCTCTG GTTTTGCTAC TTCCCACAGA TTCTCAAGTG AACTGAAAAT TGACTTACAT TTTTTTCTGA
TGATATGCTC TCTGGACGAC TTGTTAGTTT CTGATTGAAA CTTTGAACCC TGATACTAGG ATCTTACCCT TATAGCTATT
TGCTTTCTAC TAGTGATAGT GAGTAGGGAA TGTGATCGAC AATTATGCTA CTTTGCACCT TCTCTGCTTA GCCGTAAGTT
TTCAGGGGAG AACATTTTGA CCAGAAACCT TGTTAGAACA GCATTTGTTC AATAAACAGC AATTGACTCT GCCACTTTTG
TAGCGACTAC AACCATGCTC TTCCTTTATT ATGTATACTT TAAAACGATA GTTAGCCATT GATCTAGGAA GTTTACAAGC
ATACACGGTA TGCAAATATG GCCGGAAGAT AAAAGCTTAC CCTTCCATGT TCTCTGCTCT CTGTTTATAA TCTGTTTTAT
CCTGCTTAAT TTTCTCTGTT TGGTGTATGT GAAGATGGAG GAATCACCCC TCCTGAGGGG CTCCAATTGC CGGGCAAAAG
GTGCCGCTCC GGGTTTCAAG GTCGCCATCT TGGGAGCGTC TGGTGGGATT GGCCAGCCTC TTGCATTGCT CATGAAGATG
AACCCTCTTG TTTCTGTGCT CCATCTGTAC GATGTTGTCA ACACTCCCGG TGTCACAGCT GACATTAGCC ACATGAACAC
TGGTGCTGTG GTATGTTCCT TGACATTATG TTTAGTATCC CCCTATTCAT AATTGAAATA CCACATTCTG TAACCGTTGC
ATTTTGCTAC TACTTTTATG GTCAGTTGCA ATTTCTATAA TTTTCAGTTG TATGTCTTGA GGGAGGGTAC ATATGCTTCA
TCTATATTTT CCTTACATAA CATGTGAATC ATCCAGAAGA CAATCTAGTT CTGACAAATT TAATTTTTCA AACCATTGAT
TATCCAGAAT GAAAGAAACA AGTAATTCCA ATGAAACTTG TCTATCTGAT AGTCATATCT TAATAACTTA AAAGGTACTA
AGTTGGTGTC TGATCATTGA GCGGCTACTG TTGATCAAAA TACAGATATT ATATAATACT GCTAGCAATA CGTCGTAGCC
TTCATGCATA TTTAAAGTAT TTTAACTATT ATTAGATTTC AGCTTTGTAG TTTCCAGATA TCCTTTTTTT ATCACCATGT
GGTATTCCTA TAGTTATTCA TCTGTTTATT GAACCGTAAA AGGTATTTCG ATCATTGTAT TTAATTATGC TAAGGTCTCA
AATCTACAGG TGCGTGGTTT CTTGGGCCAG CCACAGTTGG AAAATGCCCT TACTGGAATG GATCTTGTGA TCATTCCTGC
TGGTGTTCCT CGTAAGCCTG GGATGACAAG GGATGATTTG TTCAACATCA ATGCCGGAAT CGTCCGGACT CTTTGTGAAG
GAATCGCAAA ATGCTGCCCC AATGCAATTG TGAATGTGAT CAGCAACCCT GTCAATTCTA CTGTTCCGAT TGCTGCTGAG
GTTTTTAAGA AAGCTGGGAC ATATGACCCT AAGCGCCTTT TGGGGGTGAC GACACTTGAT GTAGTGAGAG CCAATACTTT
TGTGGTATGA ACTTCAACAG AGTTTGCTTT GTAGTATATC ATTGTACTAA CTTTACATGG ACAGTTTCTC ATTTTTTTTT
TTTGTCTTTG TTTTGTTTAC AGGCAGAAGT TCTTGGGCTT GACCCCAGAG ATGTAAATGT CCCTGTCATT GGTGGGCATG
CAGGAGTAAC AATATTACCA CTCCTTTCAC AGGTTAGGAA TACCTTCCAT TGTTGCAAAT CTGAAATCTG AGCCACATAT
GTAGGACAAA TTAGTTTTTC TGGATATAGA CAATTAGTAT TGGATCAATG TTACCCTGTT TATTTTTTCA AAAGATTGAT
GGAATTTTAC TACTATTCCC CCTAGGTGAA TCCTCCCTGC TCATTCACCT CAGAAGAAAT TAGTTATCTT ACCACTCGCA
TACAGAATGG TGGGACAGAA GTAGTCGAGG TATGATTTTT TCTTTATCAT CTAATGATGC ATGTTTAGAA TTGTATTCAT
AAAGAAGAAA GGGAAGTTGG TTTCACAGTC CCTGATATGT ATCATGCATA ATGGTTGTAG TTGTTTGACT TGAAAGTTAA
TAAATCTGGA AAAGAATCAA CATGCTAATT TTGTTTGAAT ATAAGTGACC ACTTATAGCA TGGATACTTT CAATCCTTGT
ACATATGCAT ATTAGTTAAA TGAATTTCAT GGTGTTAACA ACAAAGTCAA GTATTAAGTG CATGTCGAAC TTTAACTAAA
TATGCCTTGA ATGTCTGTTT GCCCATATTG CATACATTTC ATGTTGTTGG CAGAAAACTA CTAGTTCAAT GCATGTTTAA
GTGTCGAAAT CCCCCTTTCT TCATTTATCA ATATAAAGGC CTCCCATGTT CTAGATTTTT CTGCTTACGT TTGCTTTTGC
TAGGTGAAAG TTTAACAGTA GTCTGTCTAA CGGTAAATGT TTTTCTATGG AGGTTACAGA GTTGTTTGTT GGCTGAAGTT
TAATGTGTTG TTCCCTATTG GCGATTCCTG TGTACTGTTG GTTTCTCAAT GTTTATATGT TGCTAATACT GAGCATTTTA
ATTCCCCCCT TCCTATTATC CATGTAGGCT AAAGCTGGAG CGGGGTCTGC AACCCTTTCA ATGGTTGGTT TCTGTCACAT
GCGTATTAGC GTATGAAGGT TAGTTCTTTT ATCAGAACAA TTAAGATTTA ACATGGACAA TTTTTCTTGT AGGCGTATGC
AGCTTCTAAA TTTGCAGATG CTTGCTTGAG AGGATTGCGT GGCGACGCTG GGATAGTGGA GTGCTCTTTT GTAGCTTCTC
AGGTTTCTTT TCTCCCTTTT ATGCTGGTTA TATTTGTCAT TTGTGTGAAC ATATATTTCT AATTTGCAAA TTTTGCTTGC
GGTGGGTATT GAAGGTGACA GAGCTGCCTT TCTTTGCATC CAAAGTGCGG TTAGGTCGCT GTGGCATCGA GGAGATCTTA
TCACTTGGTC CATTGAATGA ATTCGAAAGG TTTGTATGCT TTTCCAGTAT TTGGCATGCA TAACATGCAC TCATATTTAG
TGCTACATGC TCTTATATGC TTTTCAATGA TGTTGATCCT AAATCCCCAC ACTGTGTAAT TATCAAGCTA TCTTCTAGTA
GCGCACAACG CTTATATCGC CAGCTCATAA CAGTCTTTAA AACCTTCATG ACTTGATTGC CAGATCAGTA GATACTGACT
GGAAGTCTGC CTAATGGTTT CTATTGGACT GGGCTCAAGT ACTATTACTT GCATTTAGTA GCTCATAGCA AATACTGACA
AGTCCCCCTT TTGAAAGTGA AAAATACTGC TGAAAATATG AATGCATAAT CATGGCAGAC TGCGGCCGTA TAACAGTGCT
TAGAAAGAGT CCTGAAAGTA GAGATGCCCC ACTACAGATT GTATGGCTTC ACATTGCAAT ATAAATAATA CTATTGCCAA
GTTATCTCTT CATATCCATA CTGTAGAACT GCAGGATATA TGACCCCTCC GACAAGAACA CGCTGCGTCT GAATTGAAAG
CCTCTGCGGC ATATATATGA CAATATATGA TGCTGCATTA GGTCCACAGC CAATTAAGAT TTGATATATC CTACTGCTGT
ATTGACCTGC ATTACTGATT ATCTTCATAC ATCGCTGTCA TGCAGAGCTG GACTGGAGAA GGCTAAGAAG GAGCTGGCCG
AGAGTATCCA AAAGGGGGTC GCTTTCATCA ACAAGTGAGG CCATCTTGGA ATGCCCCAAT TTAGTTCAAC ATGGAAATAC
ACAGGCTGTG TCTTTGCTTC CTGGGGAGTG GGAAGAACAC TTGTATCATC TTGTCTCAAA TGTAAAAGCT GCCTACACGA
TGTTTATACA GCTGTAGCAG ATGCAAAAAC ACAAGTCTGC TAATAAAAGT TGCTTCTGAA TAAAAAGGAA CCCTGCTCTG
ATCTCTGCCT TGTTAATTAT GTTTCCCTGG ACAGTGAACA TCTCATCAGG TGTAATTTGA TCTTGTGATG GACTTGCAAA
TTATAGAGGA AAAAGAAAAG CGGAACTAAA TTTtacttcc tccgtttc