Os01t0100200-01

Locus

Os01g0100200

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK059894 (DDBJ, Best hit)

Protein Evidence

B8ACR2 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

006-208-E01 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0100200-01)

RiceXPro (AK059894)

Others

KEGG (Os01t0100200-01)

Transcript

1127 bp

>Os01t0100200-01 Conserved hypothetical protein.
ccttcggccctggaggcggtgggtaggacgttgacaggtgctggagcggcggcggcggcg
agcgggtgagggccagagcggcagcggagggtgtgtcggccgaTTCCCCTTCCCTTTCTT
GGCTCGCCGAAATCCCTAATCCCCATGCCGCATTTCACCTCTTCCCGCGCACAACCTCCG
CATCGCACGCGGCCGGCCTCTGCACGTTCGGCGAAGGCGGATACAGCCGGAGCACCTCGT
TTAGCATGCACCCCATCTTGGTGAGCTTTCCCATCGCCGCCGCGTCCATGGGGCCAGACC
AACCGGTCACCTCCTCCACCTCCTCCCGCACCGCCGCCCGCCACTCCGGGTGCGTCGCCA
GCATCAGTAGCGTCCACGACAGCGCCAGCGCCGTCGTAAGCTTCCTCTCTGCGGCGGCGC
TCGCCTCGTTCCCGGCCAGCAGCAGCCACAACAGGTCCGTCGTCGTCGTCTTCCTGCCGC
CGCCTTCACACCGCCGCCGCGACTCGATGATGTCGAGCAGGAGCGCGTCGATCTTGCGGC
CCAGCTTCCACGCCTCGTAGGTGGCGCGGTCCGCGCGGATATGGAGGAGGCTGGCGAGCG
GGACGCTGACGAGACGCACGCGTGGAGCGGAACAGCATCGCCTGCAGCTTTGTGGAAGAC
CGTGGCGTCGTCGGCGGCGATGCTGAAGCTGGCCTTGGCGATGATCTCGGCGGCGTTCCG
GACAACGCCCTTCTCGATGTCGATGCAGCTGTGTCCCAACGCCACTATGTCGCTCCACTC
GCCGAGCATCTTCGACGTCGTCTCCTCCATCACGCCGATCATGTCCTGCATCATCAACAA
CAGGTTGGTGGCGGAGAAGGCAGGGGCGACGATGCAGCGGTGGCGAGCCCACTCGTCGCC
CTCGGCCATGACGCGGCCTCTCCCGAACATGGGCATGCGGTTGAGCAGTTACGATATAGT
GTGCCAATTGGCACACCTACATTTTAGTCATGTATGTTGTTTAGTTTAATTTTTAATTTT
TCGATAGCCAAATATTAACTATTTAGCGACTTTATTGTCTGGTGTCCGAAGAAGAATATA
TGTAAATGACATTACCATAATAAATGTTGAATGCTTCATCAAATTTT

CDS

429 bp

>Os01t0100200-01 Conserved hypothetical protein.
ATGGAGGAGGCTGGCGAGCGGGACGCTGACGAGACGCACGCGTGGAGCGGAACAGCATCG
CCTGCAGCTTTGTGGAAGACCGTGGCGTCGTCGGCGGCGATGCTGAAGCTGGCCTTGGCG
ATGATCTCGGCGGCGTTCCGGACAACGCCCTTCTCGATGTCGATGCAGCTGTGTCCCAAC
GCCACTATGTCGCTCCACTCGCCGAGCATCTTCGACGTCGTCTCCTCCATCACGCCGATC
ATGTCCTGCATCATCAACAACAGGTTGGTGGCGGAGAAGGCAGGGGCGACGATGCAGCGG
TGGCGAGCCCACTCGTCGCCCTCGGCCATGACGCGGCCTCTCCCGAACATGGGCATGCGG
TTGAGCAGTTACGATATAGTGTGCCAATTGGCACACCTACATTTTAGTCATGTATGTTGT
TTAGTTTAA

Protein

143 aa

>Os01t0100200-01 Conserved hypothetical protein.
MEEAGERDADETHAWSGTASPAALWKTVASSAAMLKLALAMISAAFRTTPFSMSMQLCPN
ATMSLHSPSIFDVVSSITPIMSCIINNRLVAEKAGATMQRWRAHSSPSAMTRPLPNMGMR
LSSYDIVCQLAHLHFSHVCCLV*

5'UTR

chr01:11218..11797 (+ strand) : 580 bp

CDS

chr01:11798..12060 (+ strand) : 263 bp

chr01:12152..12317 (+ strand) : 166 bp

3'UTR

chr01:12318..12435 (+ strand) : 118 bp

FASTA

>Os01t0100200-01 class=Sequence position=chr01:11218..12435 (+ strand)
ccttcggccc tggaggcggt gggtaggacg ttgacaggtg ctggagcggc ggcggcggcg agcgggtgag ggccagagcg
gcagcggagg gtgtgtcggc cgaTTCCCCT TCCCTTTCTT GGCTCGCCGA AATCCCTAAT CCCCATGCCG CATTTCACCT
CTTCCCGCGC ACAACCTCCG CATCGCACGC GGCCGGCCTC TGCACGTTCG GCGAAGGCGG ATACAGCCGG AGCACCTCGT
TTAGCATGCA CCCCATCTTG GTGAGCTTTC CCATCGCCGC CGCGTCCATG GGGCCAGACC AACCGGTCAC CTCCTCCACC
TCCTCCCGCA CCGCCGCCCG CCACTCCGGG TGCGTCGCCA GCATCAGTAG CGTCCACGAC AGCGCCAGCG CCGTCGTAAG
CTTCCTCTCT GCGGCGGCGC TCGCCTCGTT CCCGGCCAGC AGCAGCCACA ACAGGTCCGT CGTCGTCGTC TTCCTGCCGC
CGCCTTCACA CCGCCGCCGC GACTCGATGA TGTCGAGCAG GAGCGCGTCG ATCTTGCGGC CCAGCTTCCA CGCCTCGTAG
GTGGCGCGGT CCGCGCGGAT ATGGAGGAGG CTGGCGAGCG GGACGCTGAC GAGACGCACG CGTGGAGCGG AACAGCATCG
CCTGCAGCTT TGTGGAAGAC CGTGGCGTCG TCGGCGGCGA TGCTGAAGCT GGCCTTGGCG ATGATCTCGG CGGCGTTCCG
GACAACGCCC TTCTCGATGT CGATGCAGCT GTGTCCCAAC GCCACTATGT CGCTCCACTC GCCGAGCATC TTCGACGTCG
TCTCCTCCAT CACGCCGATC ATGTCCTGCA TCATCAACAA CAGGTACATA TGTAGCCATC AATTAGCATC ATGTAGAATA
GTGCACGTGT TCTTGTGCAT GGAGAGAATG AATTAATTGG TTGATTACGT TGAGGTTGGT GGCGGAGAAG GCAGGGGCGA
CGATGCAGCG GTGGCGAGCC CACTCGTCGC CCTCGGCCAT GACGCGGCCT CTCCCGAACA TGGGCATGCG GTTGAGCAGT
TACGATATAG TGTGCCAATT GGCACACCTA CATTTTAGTC ATGTATGTTG TTTAGTTTAA TTTTTAATTT TTCGATAGCC
AAATATTAAC TATTTAGCGA CTTTATTGTC TGGTGTCCGA AGAAGAATAT ATGTAAATGA CATTACCATA ATAAATGTTG
AATGCTTCAT CAAATTTT