Os01t0100600-01

Locus

Os01g0100600

Description

Single-stranded nucleic acid binding R3H domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK121362 (DDBJ, Best hit)

Protein Evidence

B9EYQ6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Functional domain (InterPro)

Single-stranded nucleic acid binding R3H (IPR001374)

SUZ domain (IPR024771)

Full-length cDNA

J023124E16 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0100600-01)

RiceXPro (AK121362)

Others

KEGG (Os01t0100600-01)

Transcript

1960 bp

>Os01t0100600-01 Single-stranded nucleic acid binding R3H domain containing protein.
ACAAGTCACAGGGAGGAGTCGAAAAGAGTCAATACCAGCCGCGCCACCGCTCCCTCGCTG
ACCTGCCCGTGTTCGCCCCTCTCGCCGGCCGCCGACCCGCCCCTGCTGCTCACCGCTCCA
GCCTCCGCTCATCCCAAGCCTTCCACCACAACCCCCCACCCCTGCTCGCCCGCGCACCCA
GCTCACCAGCGCACCCGTCTGGGGTCTGCCTGCCGCTTCTCCCTCCCGTGCAGGTGCAGG
GGAAGAGGCAAGGAGGGCAAGACCGGGGCGCAGTGGGGAGTACGGAGGAAGCTGGTGCAG
CGTGGGAGAGAGGGAGCTGGAAAAGAAGGAAGAAAGGGGGGCAGTACAAGGGGGACTTGG
GAGGAGGAAGAAGGGGGAATATTTTGAGTATATGATCAATTTCGCCGTCCAATCCAGATG
TGCGCCAACCAATTCGCTATGTTCTTGTGTTGCTCTGTGCGAACGAAACTTTAAACTGGA
ACAGGTTGAGGAGCTGGCTTCACTCATCAAGGACAACCTCTACAGCAAGCACCTCGTCCT
CTCTACTGAGGAAACCCTCGTCGGGATCCTACAGAACCAGTACCACAACTCTGACGATGA
CGAGGATGAGGACGATATAGTGGCAGCATACCGCGGGACAAATAGGAATATCCTAGAGCT
CCAACCTGCCAGCTCCTATCAACGTCTTCTTTTGCATCGCCTTGCCGACATCTACGGGTT
TGTTCATGAATCTGTTGGTGAAGGTGAAGATCGACACTTAGTTCTCCAGCGCTGCCCTGA
AACTGCCATCCCACCTGTCCTCGTAAGCGACGTATTATGGGAGTATGACAACAAAGATAC
ATCGACATCTGTTGTAGTGAAGAGGAAAGATACAGATCTTGAAGAAGCCTGGAAGGAAGA
TGCCCAAGAAAATATTTCTGCTGAAATCTCGCATTTGAAAAATGATGCAGATTTGAAGGC
TTTGCAAAAGTCAGTTGCACCCCCAGCACCGTCACTCAAGGAGAGGGAAGCTGCTTATCG
AGCTGCTCGCGAGCGTATCTTCTCAGCGCATGATGCCAAGGGAAATGGGACAGCAGTGGC
AAAACCTAGGCATGTTCCTGCTGTTGCTCAACGGATGATCGCGCATGCACTTGGCAAAAA
AGTTGAGAGCCCGACAGAGACAGCAGCCGTGAAGAATGGCAAAGGAAAGGAGCCAGCGGA
AAGTAGTAGGAACAAGTTAAACCCACGCACAGCAGGTGGCAAGGAAGATAGCAGGTATGT
TGAGAATGGCAGAATGAGGTTGCACACCGGGAATCCATGTAAGCAGAGCTGGCGTACAAG
TAACAGTAGAGCTGCTAGTAGTGTTAGTCCTGATGAACTGAAGAGGGAGCAGGTTGGAGC
GGCAAAGAGGATGTTTGTGCATGCCCTGCGGCTGCCTGGTGTTGAAGGAAGTGATGGTCC
GGTGCGGAAAGGCAAGTAAGAGTCGAGTTGAGATGGGAGGTGTAATGTAGGTATTAGGAT
GGAGTGAAATGGCAACTCTGTGATGATTTTCATCTGGTGATACTATGCTGGTATAAGATG
AGATGGAAGGCCTGGTATCCCTTGGTGGAAGAAGTTGAAGCGCAAAATGCAATGCTGGGG
ATATGCAAGTGGAAGAAGTTGAAGCGCAAAATGCAATGCTGGGGGATATGCAAGTGGAAG
TGGTGAGAGCTAGCTGCTTGCCGATGGCAGCAGTTGTGGCAATATTGAGTGCAATTGACA
GGTCTTTGTTTGTTTTGTTTTTTTTTTTGCCAGAAGCTGCAGTTTAGCAGGTCCTTATTT
TCGTCAGAAGTTACAAAGAGAGAATATGCCAATTTTTAGCTTTATATTTTGCTGAAGGCA
GACAAGTTGTAGAGGAATATGCTGATCCTTAGAAAGAACTTTGTGTAGCCTATTTGGATG
GTTTCAGACTTTCAGTGATAGAGTCGGAGCAATGTTGGTC

CDS

1068 bp

>Os01t0100600-01 Single-stranded nucleic acid binding R3H domain containing protein.
ATGATCAATTTCGCCGTCCAATCCAGATGTGCGCCAACCAATTCGCTATGTTCTTGTGTT
GCTCTGTGCGAACGAAACTTTAAACTGGAACAGGTTGAGGAGCTGGCTTCACTCATCAAG
GACAACCTCTACAGCAAGCACCTCGTCCTCTCTACTGAGGAAACCCTCGTCGGGATCCTA
CAGAACCAGTACCACAACTCTGACGATGACGAGGATGAGGACGATATAGTGGCAGCATAC
CGCGGGACAAATAGGAATATCCTAGAGCTCCAACCTGCCAGCTCCTATCAACGTCTTCTT
TTGCATCGCCTTGCCGACATCTACGGGTTTGTTCATGAATCTGTTGGTGAAGGTGAAGAT
CGACACTTAGTTCTCCAGCGCTGCCCTGAAACTGCCATCCCACCTGTCCTCGTAAGCGAC
GTATTATGGGAGTATGACAACAAAGATACATCGACATCTGTTGTAGTGAAGAGGAAAGAT
ACAGATCTTGAAGAAGCCTGGAAGGAAGATGCCCAAGAAAATATTTCTGCTGAAATCTCG
CATTTGAAAAATGATGCAGATTTGAAGGCTTTGCAAAAGTCAGTTGCACCCCCAGCACCG
TCACTCAAGGAGAGGGAAGCTGCTTATCGAGCTGCTCGCGAGCGTATCTTCTCAGCGCAT
GATGCCAAGGGAAATGGGACAGCAGTGGCAAAACCTAGGCATGTTCCTGCTGTTGCTCAA
CGGATGATCGCGCATGCACTTGGCAAAAAAGTTGAGAGCCCGACAGAGACAGCAGCCGTG
AAGAATGGCAAAGGAAAGGAGCCAGCGGAAAGTAGTAGGAACAAGTTAAACCCACGCACA
GCAGGTGGCAAGGAAGATAGCAGGTATGTTGAGAATGGCAGAATGAGGTTGCACACCGGG
AATCCATGTAAGCAGAGCTGGCGTACAAGTAACAGTAGAGCTGCTAGTAGTGTTAGTCCT
GATGAACTGAAGAGGGAGCAGGTTGGAGCGGCAAAGAGGATGTTTGTGCATGCCCTGCGG
CTGCCTGGTGTTGAAGGAAGTGATGGTCCGGTGCGGAAAGGCAAGTAA

Protein

355 aa

>Os01t0100600-01 Single-stranded nucleic acid binding R3H domain containing protein.
MINFAVQSRCAPTNSLCSCVALCERNFKLEQVEELASLIKDNLYSKHLVLSTEETLVGIL
QNQYHNSDDDEDEDDIVAAYRGTNRNILELQPASSYQRLLLHRLADIYGFVHESVGEGED
RHLVLQRCPETAIPPVLVSDVLWEYDNKDTSTSVVVKRKDTDLEEAWKEDAQENISAEIS
HLKNDADLKALQKSVAPPAPSLKEREAAYRAARERIFSAHDAKGNGTAVAKPRHVPAVAQ
RMIAHALGKKVESPTETAAVKNGKGKEPAESSRNKLNPRTAGGKEDSRYVENGRMRLHTG
NPCKQSWRTSNSRAASSVSPDELKREQVGAAKRMFVHALRLPGVEGSDGPVRKGK*

5'UTR

chr01:22841..23231 (+ strand) : 391 bp

CDS

chr01:23232..23281 (+ strand) : 50 bp

chr01:23572..23847 (+ strand) : 276 bp

chr01:23962..24033 (+ strand) : 72 bp

chr01:24492..24577 (+ strand) : 86 bp

chr01:25445..25519 (+ strand) : 75 bp

chr01:25883..26391 (+ strand) : 509 bp

3'UTR

chr01:26392..26892 (+ strand) : 501 bp

FASTA

>Os01t0100600-01 class=Sequence position=chr01:22841..26892 (+ strand)
ACAAGTCACA GGGAGGAGTC GAAAAGAGTC AATACCAGCC GCGCCACCGC TCCCTCGCTG ACCTGCCCGT GTTCGCCCCT
CTCGCCGGCC GCCGACCCGC CCCTGCTGCT CACCGCTCCA GCCTCCGCTC ATCCCAAGCC TTCCACCACA ACCCCCCACC
CCTGCTCGCC CGCGCACCCA GCTCACCAGC GCACCCGTCT GGGGTCTGCC TGCCGCTTCT CCCTCCCGTG CAGGTGCAGG
GGAAGAGGCA AGGAGGGCAA GACCGGGGCG CAGTGGGGAG TACGGAGGAA GCTGGTGCAG CGTGGGAGAG AGGGAGCTGG
AAAAGAAGGA AGAAAGGGGG GCAGTACAAG GGGGACTTGG GAGGAGGAAG AAGGGGGAAT ATTTTGAGTA TATGATCAAT
TTCGCCGTCC AATCCAGATG TGCGCCAACC AATTCGCTAT GGTATAATTG ATAATAATGA TACCTTCCTT GTTGTATCTA
TCTATCTATC TATCTATCTA TCTATCTATC TATCTATCTA TCTATCTATC TATCGATTTC TTATCTTTCT TTGCTCATGC
CTGACGATGT CATGTCACAG CTGCTATGCT ATAGCAATCT CCTTACTTCA GGATTATCAT GTATGTAAAT CACTAGTAAA
TGTATTACGA GAATATATAC AATTAAGCAt gtatcacatc gatgtaattg gcttagtaca ataaagcttt cattatctaa
aaaAATTACA GTTCTTGTGT TGCTCTGTGC GAACGAAACT TTAAACTGGA ACAGGTTGAG GAGCTGGCTT CACTCATCAA
GGACAACCTC TACAGCAAGC ACCTCGTCCT CTCTACTGAG GAAACCCTCG TCGGGATCCT ACAGAACCAG TACCACAACT
CTGACGATGA CGAGGATGAG GACGATATAG TGGCAGCATA CCGCGGGACA AATAGGAATA TCCTAGAGCT CCAACCTGCC
AGCTCCTATC AACGTCTTCT TTTGCATCGC CTTGCCGACA TCTACGGGTG CTCTTTCCAA TTCCATTCGA CCTGCTTCAC
CTACCCTCTT CTCAAATACT AACTTAACTG GATAGAGTAA TATTTGCAAC TACTAATGTC TTGCTTTTGT GTCGCTGCTA
GGTTTGTTCA TGAATCTGTT GGTGAAGGTG AAGATCGACA CTTAGTTCTC CAGCGCTGCC CTGAAACTGC CATGTATGAT
ACCAAAAGTG ACCACACATC TCTTTGTTAT TGAGTGTCGT CTTATGTCTC CCTATGCCCT CATTTCGCTG TTTCTTATAC
TACAAACATG TACAGTTTAA TTTCCACCTG CATCATTCTT CAATGCAATA GAAAAAAGGG TTAATAGAAA AACACATTGT
TTCCACACAA AAAACTGTCT TCAGGGAAAT AAAACAAAAG CTATCCCGTA AACTCATGAT CACATCTTGT TTGTTATTCC
TTGCCGTCTT GCTCCAATTG CATCCCTAGT TCCACCTGTG GCGAACCATT TGGCTGCTCA CACTTTAAGA TAATCACGCC
ATTTGCCTCC CATAGCTATT GTGTTGACTC AGAGCACGGA AGCTGAAATC ACACTTTTCT TGTGACCTAC ACATGAGACA
TTATTCTGTA GTTCTATTAC CTCTGATTAC TTATTATTTC ATATTGCGCA GCCCACCTGT CCTCGTAAGC GACGTATTAT
GGGAGTATGA CAACAAAGAT ACATCGACAT CTGTTGTAGT GAAGAGGAAA GATACAGGTG AATTGTTATA ATTTCATTTT
GTGGATCATT CATGATGAAG CATTTTGATG GGGTGACACT ACCCTGTAGC ACCCATGCTG CCAATTCTGT TTGTGCTTTA
GTAAATGGTC CATGGAGAAG ATTCGTGTGT ACTTATGATC CGTTGTTCGG CTTGTCCGGG CTCAAGAAAA TTTCTGGATC
CTCCTCTGTT TTGTTCCCCT ACATAACCAC TGTATTACCT GACCAATATA TTTTTTTTTC TGAAAACAAT CATAATGCCC
TTTACTCATA ACCCTAAGAT ACCTTCCCTA ATTAATGAAA TGGGTCCATA GCGGATCAAG AAAAACTAAA AAAAAGTATG
GGAGGATAAA ATGAAGAATC AGGGCACACT AGAAATTCTC TTCGCAAAAA AATTATGAAA TGATTCCTCT TGATGGTAGT
GACCAAATCT GGAAATAGGA ACTAGGAAGT CATTGTGCAG TGCCTTAGCC TGAATTTATT TCACCCTCTC ATAAAAAGGG
ATTAAAAATG CACAGTATGG TCGTTGAGCA TGATTCGCGT GACAAAGGAG TAAAGCTGGC TGCTGGATGC CAGCTGGAGA
AATACTGGTA TTTTTTTCCA TGTGAGTTTG AAGTGGGTAG TCAATTTGAC TTACATTTTC ATCGTTCCAC AGGCATAGTT
TGATGTGTCA TAAGACATTC AGTTCCATAG ATATCTTCTT GTTATTCCCT TAAAAAAGAT ATTTCTTATT ATTCTCTCAA
GAAATTCTAA GTGCACCATC TGCACAAAGA AAAACCTATT CTACATGTAT AAATGTGATG CACTGTGCAA TCTTATGTGT
GTGTAACAGG TTAATAATTA GCATTTTGAA TTCTCTTCTA ACAGATCTTG AAGAAGCCTG GAAGGAAGAT GCCCAAGAAA
ATATTTCTGC TGAAATCTCG CATTTGAAAA ATGATGCAGG TACGTTGCGC TTGCTGTCCA CCTCTCAACA AAGCGTCTTT
CAAACTGTCT TAGGGTGTGT TTGGAACTCC AAGTTCCCAA CTCCATTGCT TTGTTTTcgt acgcttttca aactgttaaa
cgttgcgttt ttttgcaaaa agtttctata caaagttgct tttaaaaatc atattgatcc aattttgaaa aaaatagcaa
atacttaatt aatcatgtac taatggaccg ctccgttttc cgtgccaact gtttgggatg ggaaccggca tatgcgaacG
CAGCCTTAAG CTTGGTTCTC TGCATAATTT CAGTCGAGGA ATTTAAGTCT GAAAAAAAAC CCAATCAACT CTTTTATTTC
AGATTTGAAG GCTTTGCAAA AGTCAGTTGC ACCCCCAGCA CCGTCACTCA AGGAGAGGGA AGCTGCTTAT CGAGCTGCTC
GCGAGCGTAT CTTCTCAGCG CATGATGCCA AGGGAAATGG GACAGCAGTG GCAAAACCTA GGCATGTTCC TGCTGTTGCT
CAACGGATGA TCGCGCATGC ACTTGGCAAA AAAGTTGAGA GCCCGACAGA GACAGCAGCC GTGAAGAATG GCAAAGGAAA
GGAGCCAGCG GAAAGTAGTA GGAACAAGTT AAACCCACGC ACAGCAGGTG GCAAGGAAGA TAGCAGGTAT GTTGAGAATG
GCAGAATGAG GTTGCACACC GGGAATCCAT GTAAGCAGAG CTGGCGTACA AGTAACAGTA GAGCTGCTAG TAGTGTTAGT
CCTGATGAAC TGAAGAGGGA GCAGGTTGGA GCGGCAAAGA GGATGTTTGT GCATGCCCTG CGGCTGCCTG GTGTTGAAGG
AAGTGATGGT CCGGTGCGGA AAGGCAAGTA AGAGTCGAGT TGAGATGGGA GGTGTAATGT AGGTATTAGG ATGGAGTGAA
ATGGCAACTC TGTGATGATT TTCATCTGGT GATACTATGC TGGTATAAGA TGAGATGGAA GGCCTGGTAT CCCTTGGTGG
AAGAAGTTGA AGCGCAAAAT GCAATGCTGG GGATATGCAA GTGGAAGAAG TTGAAGCGCA AAATGCAATG CTGGGGGATA
TGCAAGTGGA AGTGGTGAGA GCTAGCTGCT TGCCGATGGC AGCAGTTGTG GCAATATTGA GTGCAATTGA CAGGTCTTTG
TTTGTTTTGT TTTTTTTTTT GCCAGAAGCT GCAGTTTAGC AGGTCCTTAT TTTCGTCAGA AGTTACAAAG AGAGAATATG
CCAATTTTTA GCTTTATATT TTGCTGAAGG CAGACAAGTT GTAGAGGAAT ATGCTGATCC TTAGAAAGAA CTTTGTGTAG
CCTATTTGGA TGGTTTCAGA CTTTCAGTGA TAGAGTCGGA GCAATGTTGG TC

Locus: Os01g0100600

Loading...

Locus: Os01g0100600

Loading...