Os01t0101700-00

Locus

Os01g0101700

Description

Similar to chaperone protein dnaJ 20.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjC1

Oryzabase Gene Name Synonym(s)

DnaJ domain protein C1, rice DJC26 homolog

Transcript Evidence

FP098445 (DDBJ)

Protein Evidence

NP_001151671.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, N-terminal (IPR001623)

Heat shock protein DnaJ (IPR003095)

Heat shock protein DnaJ, conserved site (IPR018253)

Expression Databases

TENOR (Os01t0101700-00)

Others

Oryzabase (12158)

Transcript

879 bp

>Os01t0101700-00 Similar to chaperone protein dnaJ 20.
GAGAGAGAGAGAGGAAGAAGCAAAGCACGGGCACCGGTGGAAGCGAAGCGAAAGTGAAAG
CATAGAGAGAAGAGAAGAGCCATGCCCCATCTCGCCGCCTCCCCCACCTCCGCCGCCGCC
GCCGCCCCTGCCTCCGCCCGCGTTGCCTTCCTGCGCCCTGGCCGCGTCCCCCGCCCGCCG
CTGCAGACAGCGCGTGGCCTTCGCCCGGACTTGGGCACCCTGCGCACGGCGGAGCAGCCC
ACGTTGTACGACCTACTCGGGATCTCCTCGGAGGGCACCCTCGACGAGGTCCGCGCGGCC
TACAGGCGGATGGCGCGCAAGTACCATCCGGACGTCTCGCCGCCCGACGCCGCCGCCGAG
AACACCCGCCGCTTCATCGAGGTGCAGGAGGCCTACGAGACGCTCTCCGACCCCAGCCGC
CGGGCCACCTACGACCGCGCCCTCGCGCGCGGCGTCTGCCGGCTTGCCTTCTCCTCCTCC
CGCCGCGTCGCCCCCTACTACTACCAGGAAGACAAGTCTGGCTGGAGGAGAACTTGGGGA
GACCAAATTGAGGAGCTGAAGAGGAGGAGCATGACGAAGGATTCAGAGGAGAACCTCTCC
TGGGGAGCTCGGATGCGAAGAAGAACCGAAACATCATCCTCTGAGTAACTGTGATCGTAA
TGCTTCCAAAGTGTAACCCTAGTGGTATATCTTTTGCATCAGCTAAATTATCATAAGCTG
TTAACAAGTGCAAGGTTAGAAGGGTGTGCTGTGCTGGTATTAAGCTGTGCATTTTGTATT
TACTCCTACAAAAGATGATGCGGCAACCCTATGCACAAGGAATGCTAAGCACTCCTCTAC
TATAGATATTAGTGGCCATTCTAGTGGTGGCATAGTTAG

CDS

567 bp

>Os01t0101700-00 Similar to chaperone protein dnaJ 20.
ATGCCCCATCTCGCCGCCTCCCCCACCTCCGCCGCCGCCGCCGCCCCTGCCTCCGCCCGC
GTTGCCTTCCTGCGCCCTGGCCGCGTCCCCCGCCCGCCGCTGCAGACAGCGCGTGGCCTT
CGCCCGGACTTGGGCACCCTGCGCACGGCGGAGCAGCCCACGTTGTACGACCTACTCGGG
ATCTCCTCGGAGGGCACCCTCGACGAGGTCCGCGCGGCCTACAGGCGGATGGCGCGCAAG
TACCATCCGGACGTCTCGCCGCCCGACGCCGCCGCCGAGAACACCCGCCGCTTCATCGAG
GTGCAGGAGGCCTACGAGACGCTCTCCGACCCCAGCCGCCGGGCCACCTACGACCGCGCC
CTCGCGCGCGGCGTCTGCCGGCTTGCCTTCTCCTCCTCCCGCCGCGTCGCCCCCTACTAC
TACCAGGAAGACAAGTCTGGCTGGAGGAGAACTTGGGGAGACCAAATTGAGGAGCTGAAG
AGGAGGAGCATGACGAAGGATTCAGAGGAGAACCTCTCCTGGGGAGCTCGGATGCGAAGA
AGAACCGAAACATCATCCTCTGAGTAA

Protein

188 aa

>Os01t0101700-00 Similar to chaperone protein dnaJ 20.
MPHLAASPTSAAAAAPASARVAFLRPGRVPRPPLQTARGLRPDLGTLRTAEQPTLYDLLG
ISSEGTLDEVRAAYRRMARKYHPDVSPPDAAAENTRRFIEVQEAYETLSDPSRRATYDRA
LARGVCRLAFSSSRRVAPYYYQEDKSGWRRTWGDQIEELKRRSMTKDSEENLSWGARMRR
RTETSSSE*

5'UTR

chr01:82426..82506 (+ strand) : 81 bp

CDS

chr01:82507..82932 (+ strand) : 426 bp

chr01:83724..83864 (+ strand) : 141 bp

3'UTR

chr01:83865..84095 (+ strand) : 231 bp

FASTA

>Os01t0101700-00 class=Sequence position=chr01:82426..84095 (+ strand)
GAGAGAGAGA GAGGAAGAAG CAAAGCACGG GCACCGGTGG AAGCGAAGCG AAAGTGAAAG CATAGAGAGA AGAGAAGAGC
CATGCCCCAT CTCGCCGCCT CCCCCACCTC CGCCGCCGCC GCCGCCCCTG CCTCCGCCCG CGTTGCCTTC CTGCGCCCTG
GCCGCGTCCC CCGCCCGCCG CTGCAGACAG CGCGTGGCCT TCGCCCGGAC TTGGGCACCC TGCGCACGGC GGAGCAGCCC
ACGTTGTACG ACCTACTCGG GATCTCCTCG GAGGGCACCC TCGACGAGGT CCGCGCGGCC TACAGGCGGA TGGCGCGCAA
GTACCATCCG GACGTCTCGC CGCCCGACGC CGCCGCCGAG AACACCCGCC GCTTCATCGA GGTGCAGGAG GCCTACGAGA
CGCTCTCCGA CCCCAGCCGC CGGGCCACCT ACGACCGCGC CCTCGCGCGC GGCGTCTGCC GGCTTGCCTT CTCCTCCTCC
CGCCGCGTCG CCCCCTACTA CTACCAGGTA CGTTTCGTCT CCTCTCCTCT CCTCTCTAGT GATTTTGATT TGAATTTGTC
CCCAACCTTC AACACAAGCC CATTCAGTTT CTAACACACA AGCCCCAGCC TTACATGATG TTTGATCCAG CAGCCTGACT
TAATATGTCT GCTCCATCTT CTCCCCCATT CAATTCAATA CTTGATTGCA ATTCCTTCTA TCTTTCTTGT ATCACCGTCG
TCTGCAGCAC ATAACTCAAT ATTGCGCCTG CATGTGCTTG TGTATTTGTA CAGATTTTGG CTTCATATAT ATATATATAT
ATATATTATT GCTCAAGTTC GCTGGATCAA TTCATCATAA CTCTATGTAG GATGCGAGTA GAGATTTACC TTTTGTTCAG
GCACTAGCAG TGCCATACAT ACAAATAAGG AAATACTACA TACATAGGCA TTATCTCTTG CGTGATGCAT ATAGGGATGC
AAAATTCACC CTGATGCAAA TTATATGCAT GTAGGTGATG AATAGTGAAT GAACAATTAT ACTTACAAAC AAAATTGAAA
AAAAGAAGTC TTTTTCGTGT GCCTCATAGT TAAACTTATC CAGGACATAA GTTAGAGAGG TCGTGTCTTC CGTGTAAGGT
TGAAACTGGG AGAAGCTTTG CTTGTTTGGC TATTCTGTTA GCTGATTTCT ACTTTCACTC GGTTCATGAT GTTGATCCGC
AAGTTGGTAA TTTCCATTTG GATTGTCAAA CCATTGTTTC ATATGCTGTT TTTTCCATGC TAACTTGCCA CCCGTGTGAC
TCAAAACCAT AGGATCAGGA AGACAAGTCT GGCTGGAGGA GAACTTGGGG AGACCAAATT GAGGAGCTGA AGAGGAGGAG
CATGACGAAG GATTCAGAGG AGAACCTCTC CTGGGGAGCT CGGATGCGAA GAAGAACCGA AACATCATCC TCTGAGTAAC
TGTGATCGTA ATGCTTCCAA AGTGTAACCC TAGTGGTATA TCTTTTGCAT CAGCTAAATT ATCATAAGCT GTTAACAAGT
GCAAGGTTAG AAGGGTGTGC TGTGCTGGTA TTAAGCTGTG CATTTTGTAT TTACTCCTAC AAAAGATGAT GCGGCAACCC
TATGCACAAG GAATGCTAAG CACTCCTCTA CTATAGATAT TAGTGGCCAT TCTAGTGGTG GCATAGTTAG 

Locus: Os01g0101700

Loading...

Locus: Os01g0101700

Loading...