Os01t0102000-01

Locus

Os01g0102000

Description

Non-specific phospholipase C, Mesocotyl development

RAP-DB Gene Symbol Synonym(s)

OsNPC6

RAP-DB Gene Name Synonym(s)

non-specific phospholipase C6

CGSNL Gene Symbol

NPC5

CGSNL Gene Name

NON-SPECIFIC PHOSPHOLIPASE C5

Oryzabase Gene Symbol Synonym(s)

OsNPC6, OsNPC5, NPC6

Oryzabase Gene Name Synonym(s)

Non-specific phospholipase C5

Transcript Evidence

AK101065 (truncated)

Inferred from literature

Protein Evidence

Inferred from literature

Literature

PMID: 34021760

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

May 24, 2021

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: hydrolase activity, acting on ester bonds (GO:0016788)

Functional domain (InterPro)

Alkaline-phosphatase-like, core domain superfamily (IPR017850)

Phosphoesterase (IPR007312)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

J033023E01 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0102000-01)

RiceXPro (AK101065)

Others

Oryzabase (21052)

KEGG (Os01t0102000-01)

Transcript

1759 bp

>Os01t0102000-01 Non-specific phospholipase C, Mesocotyl development
ATTTTCTTTTTCTCTAGCTTGTTGTACTTGGTACTCCACACCACTAGCTAGTAATGTGGC
CGCTCTCTCCTCACCGACGGCATCTCCAGCAGCACGGGCATTCCGGCGCCATGGGTCGGC
GGCTGTTGCTGCTCTTCCTAATGCTGGCACAGGCACCCAATTCCAATGGGGATTCCAAGA
TAAAGAACGTGGTGGTGTTGGCGCTGGAGAACCGGTCGTTCGACCACATGCTGGGGTGGA
TGCAGCGGCTGCTGGGCCTCCCCATCGACGGCCTCACCGGCGCAGAGTGCAACCCGGCTC
CAGGACCAGGTCCAGCCGACTCCCTCCTCCACTGCGTCTCCCCCGACGCCGACCTCGTCG
TCCCCGACGACCCCGCCCACGCCTTCGAGGACGTCCTCGAGCAGCTGCTGGGGTTCCGAC
CCAATGACTCTACTGGCGCCGCCGCCTCCCCCTCAGACATGTCGGGCTTCGTCCGCAGCG
CCGTCTCCGTGAGCGCGCTCCTGACCGACGCCGTCATGCGGGGGTTCACCCCGTCGCGGC
TCCCGGCCTTCTCCGCGCTGGCCTCCTCCTTCGCGGTGTTCGACCGCTGGTTCTCCTCCA
TCCCGGGGCCCACGCAGCCCAACCGGCTGTTCCTCTACTCCGCCACCTCCCACGGCGCCG
TCGCCCACGACAAGTGGAACCTCCTCCGCGGCTACCCGCAGCGCACCATCTTTGACTCCC
TCGCCGCCGACGCCCTCGACTACCGGGTCTACTTCAAGACCATCCCCACCACCCTCTTCT
ACCGCcgcctccgcaccgtcgccaacgccgcccgcggcaccttccgccgctacgacgccg
ccttccgcgaccacgcccgcaggggcctcctcccggcgctctccgtcatcgagccacgct
acttcgacctcaccggcacgcccgccgacgacgaccacccggcgcacgacgtcgccaacg
gccagaggctggtcaaggacgtctacgaggcgctgcgggcgggcccgcagtggaaccaca
cactgctcatcatcacctacgacgagcacggcggcttctacgaccacgtcccgccgccca
atgtcggcgtccccagccccgacgccatccgtggcccgctgcccttcttcttcaggttcg
accgcctcggcgtcAGGGTGCCCACCATCATGGTGTCGCCGTGGATCAGGAAAGGGACGG
TGGTGGGGAGGCCGCCGGGAGGGCCAACGCCCACGtccgagtacgagcactcctccatcc
cggccaccatcaagaagatattcaacctcagctccgacttcctcaccaggagggatgcgt
gggcgggcaccttcgagcacctcttcacggacctggacgagccaaGGACGGATTGCCCGG
AGACATTGCCGGAGATCCCGCCGCCATCTTCCTCGTCGTCGTCGACCAAGAAAGAAGACG
GAGGATGGCTGTCGGACTTCCAGCGCGAGCTGGTGCAGCTGGCGGCCTTCCTCAACGGCG
ACTACATGCTGTCAAGCTTCGCACAGGAGTACGAGTCGAGAATGACGATGACGGTGAAGC
AGGCGGATGCGTATGTGAGGCGAGCCGTCAAAAGTTTCCTGGAGGCCAGCAAGCGGGCCA
AACGCTTAGGTGCAAACGACTCCGCCATTGTAACCATGAGACCATCCCTCACTACTGCAA
CCACCTGCTGCCCTTAGTTACCTACTGTAGTACACTAAACTAGTCTCTTTATTAATTTAA
TTAATTACCTACCTTAGCT

CDS

1644 bp

>Os01t0102000-01 Non-specific phospholipase C, Mesocotyl development
ATGTGGCCGCTCTCTCCTCACCGACGGCATCTCCAGCAGCACGGGCATTCCGGCGCCATG
GGTCGGCGGCTGTTGCTGCTCTTCCTAATGCTGGCACAGGCACCCAATTCCAATGGGGAT
TCCAAGATAAAGAACGTGGTGGTGTTGGCGCTGGAGAACCGGTCGTTCGACCACATGCTG
GGGTGGATGCAGCGGCTGCTGGGCCTCCCCATCGACGGCCTCACCGGCGCAGAGTGCAAC
CCGGCTCCAGGACCAGGTCCAGCCGACTCCCTCCTCCACTGCGTCTCCCCCGACGCCGAC
CTCGTCGTCCCCGACGACCCCGCCCACGCCTTCGAGGACGTCCTCGAGCAGCTGCTGGGG
TTCCGACCCAATGACTCTACTGGCGCCGCCGCCTCCCCCTCAGACATGTCGGGCTTCGTC
CGCAGCGCCGTCTCCGTGAGCGCGCTCCTGACCGACGCCGTCATGCGGGGGTTCACCCCG
TCGCGGCTCCCGGCCTTCTCCGCGCTGGCCTCCTCCTTCGCGGTGTTCGACCGCTGGTTC
TCCTCCATCCCGGGGCCCACGCAGCCCAACCGGCTGTTCCTCTACTCCGCCACCTCCCAC
GGCGCCGTCGCCCACGACAAGTGGAACCTCCTCCGCGGCTACCCGCAGCGCACCATCTTT
GACTCCCTCGCCGCCGACGCCCTCGACTACCGGGTCTACTTCAAGACCATCCCCACCACC
CTCTTCTACCGCcgcctccgcaccgtcgccaacgccgcccgcggcaccttccgccgctac
gacgccgccttccgcgaccacgcccgcaggggcctcctcccggcgctctccgtcatcgag
ccacgctacttcgacctcaccggcacgcccgccgacgacgaccacccggcgcacgacgtc
gccaacggccagaggctggtcaaggacgtctacgaggcgctgcgggcgggcccgcagtgg
aaccacacactgctcatcatcacctacgacgagcacggcggcttctacgaccacgtcccg
ccgcccaatgtcggcgtccccagccccgacgccatccgtggcccgctgcccttcttcttc
aggttcgaccgcctcggcgtcAGGGTGCCCACCATCATGGTGTCGCCGTGGATCAGGAAA
GGGACGGTGGTGGGGAGGCCGCCGGGAGGGCCAACGCCCACGtccgagtacgagcactcc
tccatcccggccaccatcaagaagatattcaacctcagctccgacttcctcaccaggagg
gatgcgtgggcgggcaccttcgagcacctcttcacggacctggacgagccaaGGACGGAT
TGCCCGGAGACATTGCCGGAGATCCCGCCGCCATCTTCCTCGTCGTCGTCGACCAAGAAA
GAAGACGGAGGATGGCTGTCGGACTTCCAGCGCGAGCTGGTGCAGCTGGCGGCCTTCCTC
AACGGCGACTACATGCTGTCAAGCTTCGCACAGGAGTACGAGTCGAGAATGACGATGACG
GTGAAGCAGGCGGATGCGTATGTGAGGCGAGCCGTCAAAAGTTTCCTGGAGGCCAGCAAG
CGGGCCAAACGCTTAGGTGCAAACGACTCCGCCATTGTAACCATGAGACCATCCCTCACT
ACTGCAACCACCTGCTGCCCTTAG

Protein

547 aa

>Os01t0102000-01 Non-specific phospholipase C, Mesocotyl development
MWPLSPHRRHLQQHGHSGAMGRRLLLLFLMLAQAPNSNGDSKIKNVVVLALENRSFDHML
GWMQRLLGLPIDGLTGAECNPAPGPGPADSLLHCVSPDADLVVPDDPAHAFEDVLEQLLG
FRPNDSTGAAASPSDMSGFVRSAVSVSALLTDAVMRGFTPSRLPAFSALASSFAVFDRWF
SSIPGPTQPNRLFLYSATSHGAVAHDKWNLLRGYPQRTIFDSLAADALDYRVYFKTIPTT
LFYRRLRTVANAARGTFRRYDAAFRDHARRGLLPALSVIEPRYFDLTGTPADDDHPAHDV
ANGQRLVKDVYEALRAGPQWNHTLLIITYDEHGGFYDHVPPPNVGVPSPDAIRGPLPFFF
RFDRLGVRVPTIMVSPWIRKGTVVGRPPGGPTPTSEYEHSSIPATIKKIFNLSSDFLTRR
DAWAGTFEHLFTDLDEPRTDCPETLPEIPPPSSSSSSTKKEDGGWLSDFQRELVQLAAFL
NGDYMLSSFAQEYESRMTMTVKQADAYVRRAVKSFLEASKRAKRLGANDSAIVTMRPSLT
TATTCCP*

5'UTR

chr01:91469..91521 (- strand) : 53 bp

CDS

chr01:89825..91468 (- strand) : 1644 bp

3'UTR

chr01:89763..89824 (- strand) : 62 bp

FASTA

>Os01t0102000-01 class=Sequence position=chr01:89763..91521 (- strand)
ATTTTCTTTT TCTCTAGCTT GTTGTACTTG GTACTCCACA CCACTAGCTA GTAATGTGGC CGCTCTCTCC TCACCGACGG
CATCTCCAGC AGCACGGGCA TTCCGGCGCC ATGGGTCGGC GGCTGTTGCT GCTCTTCCTA ATGCTGGCAC AGGCACCCAA
TTCCAATGGG GATTCCAAGA TAAAGAACGT GGTGGTGTTG GCGCTGGAGA ACCGGTCGTT CGACCACATG CTGGGGTGGA
TGCAGCGGCT GCTGGGCCTC CCCATCGACG GCCTCACCGG CGCAGAGTGC AACCCGGCTC CAGGACCAGG TCCAGCCGAC
TCCCTCCTCC ACTGCGTCTC CCCCGACGCC GACCTCGTCG TCCCCGACGA CCCCGCCCAC GCCTTCGAGG ACGTCCTCGA
GCAGCTGCTG GGGTTCCGAC CCAATGACTC TACTGGCGCC GCCGCCTCCC CCTCAGACAT GTCGGGCTTC GTCCGCAGCG
CCGTCTCCGT GAGCGCGCTC CTGACCGACG CCGTCATGCG GGGGTTCACC CCGTCGCGGC TCCCGGCCTT CTCCGCGCTG
GCCTCCTCCT TCGCGGTGTT CGACCGCTGG TTCTCCTCCA TCCCGGGGCC CACGCAGCCC AACCGGCTGT TCCTCTACTC
CGCCACCTCC CACGGCGCCG TCGCCCACGA CAAGTGGAAC CTCCTCCGCG GCTACCCGCA GCGCACCATC TTTGACTCCC
TCGCCGCCGA CGCCCTCGAC TACCGGGTCT ACTTCAAGAC CATCCCCACC ACCCTCTTCT ACCGCcgcct ccgcaccgtc
gccaacgccg cccgcggcac cttccgccgc tacgacgccg ccttccgcga ccacgcccgc aggggcctcc tcccggcgct
ctccgtcatc gagccacgct acttcgacct caccggcacg cccgccgacg acgaccaccc ggcgcacgac gtcgccaacg
gccagaggct ggtcaaggac gtctacgagg cgctgcgggc gggcccgcag tggaaccaca cactgctcat catcacctac
gacgagcacg gcggcttcta cgaccacgtc ccgccgccca atgtcggcgt ccccagcccc gacgccatcc gtggcccgct
gcccttcttc ttcaggttcg accgcctcgg cgtcAGGGTG CCCACCATCA TGGTGTCGCC GTGGATCAGG AAAGGGACGG
TGGTGGGGAG GCCGCCGGGA GGGCCAACGC CCACGtccga gtacgagcac tcctccatcc cggccaccat caagaagata
ttcaacctca gctccgactt cctcaccagg agggatgcgt gggcgggcac cttcgagcac ctcttcacgg acctggacga
gccaaGGACG GATTGCCCGG AGACATTGCC GGAGATCCCG CCGCCATCTT CCTCGTCGTC GTCGACCAAG AAAGAAGACG
GAGGATGGCT GTCGGACTTC CAGCGCGAGC TGGTGCAGCT GGCGGCCTTC CTCAACGGCG ACTACATGCT GTCAAGCTTC
GCACAGGAGT ACGAGTCGAG AATGACGATG ACGGTGAAGC AGGCGGATGC GTATGTGAGG CGAGCCGTCA AAAGTTTCCT
GGAGGCCAGC AAGCGGGCCA AACGCTTAGG TGCAAACGAC TCCGCCATTG TAACCATGAG ACCATCCCTC ACTACTGCAA
CCACCTGCTG CCCTTAGTTA CCTACTGTAG TACACTAAAC TAGTCTCTTT ATTAATTTAA TTAATTACCT ACCTTAGCT

Locus: Os01g0102000

Loading...

Locus: Os01g0102000

Loading...