Os01t0102000-01

Locus

Os01g0102000

Description

Phosphoesterase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NPC5

CGSNL Gene Name

NON-SPECIFIC PHOSPHOLIPASE C5

Oryzabase Gene Symbol Synonym(s)

OsNPC6, OsNPC5, NPC6

Oryzabase Gene Name Synonym(s)

Non-specific phospholipase C5

Transcript Evidence

AK101065 (DDBJ, Best hit)

Protein Evidence

NP_190430.2 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: hydrolase activity, acting on ester bonds (GO:0016788)

Functional domain (InterPro)

Phosphoesterase (IPR007312)

Full-length cDNA

J033023E01 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0102000-01)

RiceXPro (AK101065)

Others

Oryzabase (21052)

KEGG (Os01t0102000-01)

Transcript

1703 bp

>Os01t0102000-01 Phosphoesterase family protein.
TGGCCGCTCTCTCCTCACCGACGGCATCTCCAGCAGCACGGGCATTCCGGCGCCATGGGT
CGGCGGCTGTTGCTGCTCTTCCTAATGCTGGCACAGGCACCCAATTCCAATGGGGATTCC
AAGATAAAGAACGTGGTGGTGTTGGCGCTGGAGAACCGGTCGTTCGACCACATGCTGGGG
TGGATGCAGCGGCTGCTGGGCCTCCCCATCGACGGCCTCACCGGCGCAGAGTGCAACCCG
GCTCCAGGACCAGGTCCAGCCGACTCCCTCCTCCACTGCGTCTCCCCCGACGCCGACCTC
GTCGTCCCCGACGACCCCGCCCACGCCTTCGAGGACGTCCTCGAGCAGCTGCTGGGGTTC
CGACCCAATGACTCTACTGGCGCCGCCGCCTCCCCCTCAGACATGTCGGGCTTCGTCCGC
AGCGCCGTCTCCGTGAGCGCGCTCCTGACCGACGCCGTCATGCGGGGGTTCACCCCGTCG
CGGCTCCCGGCCTTCTCCGCGCTGGCCTCCTCCTTCGCGGTGTTCGACCGCTGGTTCTCC
TCCATCCCGGGGCCCACGCAGCCCAACCGGCTGTTCCTCTACTCCGCCACCTCCCACGGC
GCCGTCGCCCACGACAAGTGGAACCTCCTCCGCGGCTACCCGCAGCGCACCATCTTTGAC
TCCCTCGCCGCCGACGCCCTCGACTACCGGGTCTACTTCAAGACCATCCCCACCACCCTC
TTCTACCGCcgcctccgcaccgtcgccaacgccgcccgcggcaccttccgccgctacgac
gccgccttccgcgaccacgcccgcaggggcctcctcccggcgctctccgtcatcgagcca
cgctacttcgacctcaccggcacgcccgccgacgacgaccacccggcgcacgacgtcgcc
aacggccagaggctggtcaaggacgtctacgaggcgctgcgggcgggcccgcagtggaac
cacacactgctcatcatcacctacgacgagcacggcggcttctacgaccacgtcccgccg
cccaatgtcggcgtccccagccccgacgccatccgtggcccgctgcccttcttcttcagg
ttcgaccgcctcggcgtcAGGGTGCCCACCATCATGGTGTCGCCGTGGATCAGGAAAGGG
ACGGTGGTGGGGAGGCCGCCGGGAGGGCCAACGCCCACGtccgagtacgagcactcctcc
atcccggccaccatcaagaagatattcaacctcagctccgacttcctcaccaggagggat
gcgtgggcgggcaccttcgagcacctcttcacggacctggacgagccaaGGACGGATTGC
CCGGAGACATTGCCGGAGATCCCGCCGCCATCTTCCTCGTCGTCGTCGACCAAGAAAGAA
GACGGAGGATGGCTGTCGGACTTCCAGCGCGAGCTGGTGCAGCTGGCGGCCTTCCTCAAC
GGCGACTACATGCTGTCAAGCTTCGCACAGGAGTACGAGTCGAGAATGACGATGACGGTG
AAGCAGGCGGATGCGTATGTGAGGCGAGCCGTCAAAAGTTTCCTGGAGGCCAGCAAGCGG
GCCAAACGCTTAGGTGCAAACGACTCCGCCATTGTAACCATGAGACCATCCCTCACTACT
GCAACCACCTGCTGCCCTTAGTTACCTACTGTAGTACACTAAACTAGTCTCTTTATTAAT
TTAATTAATTACCTACCTTAGCT

CDS

1587 bp

>Os01t0102000-01 Phosphoesterase family protein.
ATGGGTCGGCGGCTGTTGCTGCTCTTCCTAATGCTGGCACAGGCACCCAATTCCAATGGG
GATTCCAAGATAAAGAACGTGGTGGTGTTGGCGCTGGAGAACCGGTCGTTCGACCACATG
CTGGGGTGGATGCAGCGGCTGCTGGGCCTCCCCATCGACGGCCTCACCGGCGCAGAGTGC
AACCCGGCTCCAGGACCAGGTCCAGCCGACTCCCTCCTCCACTGCGTCTCCCCCGACGCC
GACCTCGTCGTCCCCGACGACCCCGCCCACGCCTTCGAGGACGTCCTCGAGCAGCTGCTG
GGGTTCCGACCCAATGACTCTACTGGCGCCGCCGCCTCCCCCTCAGACATGTCGGGCTTC
GTCCGCAGCGCCGTCTCCGTGAGCGCGCTCCTGACCGACGCCGTCATGCGGGGGTTCACC
CCGTCGCGGCTCCCGGCCTTCTCCGCGCTGGCCTCCTCCTTCGCGGTGTTCGACCGCTGG
TTCTCCTCCATCCCGGGGCCCACGCAGCCCAACCGGCTGTTCCTCTACTCCGCCACCTCC
CACGGCGCCGTCGCCCACGACAAGTGGAACCTCCTCCGCGGCTACCCGCAGCGCACCATC
TTTGACTCCCTCGCCGCCGACGCCCTCGACTACCGGGTCTACTTCAAGACCATCCCCACC
ACCCTCTTCTACCGCcgcctccgcaccgtcgccaacgccgcccgcggcaccttccgccgc
tacgacgccgccttccgcgaccacgcccgcaggggcctcctcccggcgctctccgtcatc
gagccacgctacttcgacctcaccggcacgcccgccgacgacgaccacccggcgcacgac
gtcgccaacggccagaggctggtcaaggacgtctacgaggcgctgcgggcgggcccgcag
tggaaccacacactgctcatcatcacctacgacgagcacggcggcttctacgaccacgtc
ccgccgcccaatgtcggcgtccccagccccgacgccatccgtggcccgctgcccttcttc
ttcaggttcgaccgcctcggcgtcAGGGTGCCCACCATCATGGTGTCGCCGTGGATCAGG
AAAGGGACGGTGGTGGGGAGGCCGCCGGGAGGGCCAACGCCCACGtccgagtacgagcac
tcctccatcccggccaccatcaagaagatattcaacctcagctccgacttcctcaccagg
agggatgcgtgggcgggcaccttcgagcacctcttcacggacctggacgagccaaGGACG
GATTGCCCGGAGACATTGCCGGAGATCCCGCCGCCATCTTCCTCGTCGTCGTCGACCAAG
AAAGAAGACGGAGGATGGCTGTCGGACTTCCAGCGCGAGCTGGTGCAGCTGGCGGCCTTC
CTCAACGGCGACTACATGCTGTCAAGCTTCGCACAGGAGTACGAGTCGAGAATGACGATG
ACGGTGAAGCAGGCGGATGCGTATGTGAGGCGAGCCGTCAAAAGTTTCCTGGAGGCCAGC
AAGCGGGCCAAACGCTTAGGTGCAAACGACTCCGCCATTGTAACCATGAGACCATCCCTC
ACTACTGCAACCACCTGCTGCCCTTAG

Protein

529 aa

>Os01t0102000-01 Phosphoesterase family protein.
MGRRLLLLFLMLAQAPNSNGDSKIKNVVVLALENRSFDHMLGWMQRLLGLPIDGLTGAEC
NPAPGPGPADSLLHCVSPDADLVVPDDPAHAFEDVLEQLLGFRPNDSTGAAASPSDMSGF
VRSAVSVSALLTDAVMRGFTPSRLPAFSALASSFAVFDRWFSSIPGPTQPNRLFLYSATS
HGAVAHDKWNLLRGYPQRTIFDSLAADALDYRVYFKTIPTTLFYRRLRTVANAARGTFRR
YDAAFRDHARRGLLPALSVIEPRYFDLTGTPADDDHPAHDVANGQRLVKDVYEALRAGPQ
WNHTLLIITYDEHGGFYDHVPPPNVGVPSPDAIRGPLPFFFRFDRLGVRVPTIMVSPWIR
KGTVVGRPPGGPTPTSEYEHSSIPATIKKIFNLSSDFLTRRDAWAGTFEHLFTDLDEPRT
DCPETLPEIPPPSSSSSSTKKEDGGWLSDFQRELVQLAAFLNGDYMLSSFAQEYESRMTM
TVKQADAYVRRAVKSFLEASKRAKRLGANDSAIVTMRPSLTTATTCCP*

5'UTR

chr01:91412..91465 (- strand) : 54 bp

CDS

chr01:89825..91411 (- strand) : 1587 bp

3'UTR

chr01:89763..89824 (- strand) : 62 bp

FASTA

>Os01t0102000-01 class=Sequence position=chr01:89763..91465 (- strand)
TGGCCGCTCT CTCCTCACCG ACGGCATCTC CAGCAGCACG GGCATTCCGG CGCCATGGGT CGGCGGCTGT TGCTGCTCTT
CCTAATGCTG GCACAGGCAC CCAATTCCAA TGGGGATTCC AAGATAAAGA ACGTGGTGGT GTTGGCGCTG GAGAACCGGT
CGTTCGACCA CATGCTGGGG TGGATGCAGC GGCTGCTGGG CCTCCCCATC GACGGCCTCA CCGGCGCAGA GTGCAACCCG
GCTCCAGGAC CAGGTCCAGC CGACTCCCTC CTCCACTGCG TCTCCCCCGA CGCCGACCTC GTCGTCCCCG ACGACCCCGC
CCACGCCTTC GAGGACGTCC TCGAGCAGCT GCTGGGGTTC CGACCCAATG ACTCTACTGG CGCCGCCGCC TCCCCCTCAG
ACATGTCGGG CTTCGTCCGC AGCGCCGTCT CCGTGAGCGC GCTCCTGACC GACGCCGTCA TGCGGGGGTT CACCCCGTCG
CGGCTCCCGG CCTTCTCCGC GCTGGCCTCC TCCTTCGCGG TGTTCGACCG CTGGTTCTCC TCCATCCCGG GGCCCACGCA
GCCCAACCGG CTGTTCCTCT ACTCCGCCAC CTCCCACGGC GCCGTCGCCC ACGACAAGTG GAACCTCCTC CGCGGCTACC
CGCAGCGCAC CATCTTTGAC TCCCTCGCCG CCGACGCCCT CGACTACCGG GTCTACTTCA AGACCATCCC CACCACCCTC
TTCTACCGCc gcctccgcac cgtcgccaac gccgcccgcg gcaccttccg ccgctacgac gccgccttcc gcgaccacgc
ccgcaggggc ctcctcccgg cgctctccgt catcgagcca cgctacttcg acctcaccgg cacgcccgcc gacgacgacc
acccggcgca cgacgtcgcc aacggccaga ggctggtcaa ggacgtctac gaggcgctgc gggcgggccc gcagtggaac
cacacactgc tcatcatcac ctacgacgag cacggcggct tctacgacca cgtcccgccg cccaatgtcg gcgtccccag
ccccgacgcc atccgtggcc cgctgccctt cttcttcagg ttcgaccgcc tcggcgtcAG GGTGCCCACC ATCATGGTGT
CGCCGTGGAT CAGGAAAGGG ACGGTGGTGG GGAGGCCGCC GGGAGGGCCA ACGCCCACGt ccgagtacga gcactcctcc
atcccggcca ccatcaagaa gatattcaac ctcagctccg acttcctcac caggagggat gcgtgggcgg gcaccttcga
gcacctcttc acggacctgg acgagccaaG GACGGATTGC CCGGAGACAT TGCCGGAGAT CCCGCCGCCA TCTTCCTCGT
CGTCGTCGAC CAAGAAAGAA GACGGAGGAT GGCTGTCGGA CTTCCAGCGC GAGCTGGTGC AGCTGGCGGC CTTCCTCAAC
GGCGACTACA TGCTGTCAAG CTTCGCACAG GAGTACGAGT CGAGAATGAC GATGACGGTG AAGCAGGCGG ATGCGTATGT
GAGGCGAGCC GTCAAAAGTT TCCTGGAGGC CAGCAAGCGG GCCAAACGCT TAGGTGCAAA CGACTCCGCC ATTGTAACCA
TGAGACCATC CCTCACTACT GCAACCACCT GCTGCCCTTA GTTACCTACT GTAGTACACT AAACTAGTCT CTTTATTAAT
TTAATTAATT ACCTACCTTA GCT

Locus: Os01g0102000

Loading...

Locus: Os01g0102000

Loading...