Os01t0102300-01

Locus

Os01g0102300

Description

Thylakoid lumen protein, Photosynthesis and chloroplast development

RAP-DB Gene Symbol Synonym(s)

OsTLP27

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TLP27

CGSNL Gene Name

THYLAKOID LUMENAL PROTEIN 27

Oryzabase Gene Symbol Synonym(s)

OsTLP27

Oryzabase Gene Name Synonym(s)

Thylakoid lumenal protein 27

Transcript Evidence

AK067320

Protein Evidence

Q94CX1

Literature

PMID: 22921006

Note

Manual Curation

March 7, 2017

Experimentally confirmed subcellular location

chloroplast (GO:0009507)

Full-length cDNA

J013106P10 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0102300-01)

RiceXPro (AK067320)

Others

Oryzabase (22606)

KEGG (Os01t0102300-01)

Transcript

971 bp

>Os01t0102300-01 Thylakoid lumen protein, Photosynthesis and chloroplast development
GTACGTTTGTAATGACGTCATCATTATCATCATCCACAGCCTCTGCTGCTGCTTGTTGCA
AGAGTAGAAGTCGTAATCCTCCTCCGGCGCCGGCGCCACACACTAGTACTGCACGAGTAG
TTCGCAGCAGCAGGCGGAGGCTTCTCTTAGTATTCTTCTCCGCAGAGGCGGCGGCGGCTG
CGACGAGCGGTCTCATCCAGACCCCGTGTGGGCAAGCCTACCCTTTCGCTGGCACCAACG
TGAAGAAGCCGCAGCCGCCGTCCACCCCTTACTCCCAATCCCAATCGCAGCAGCAGTTTG
GCCTCGACGCCAAAGGGAGGATTAGGGCGTGCCCGTCGACGAACCCCGGATGCGTGTCCA
CAAACCCCACGGTGGGCGCATCTTGCTCCTTGGCCTCCCCGCTCATCGTCCCCGCTAATA
CACCAACGGACAAGGCCGCCGCTTCGCTGCGCGAGGCTATCCTCAAGACGCAGAGGAATG
CGGTGATCAAAGCCGACGAGGAGACGGCGTACGGGCACTACATCCAGGCGGAGGTCGACG
GCGGCGCAGGCCGCGACGTGATGGAGTTCCTCCTCAAGGAATCCCAGTCCCAGTCCCAGG
AGGTGGTGGCCGCGTACCGATGCGTCGCCACCAAGGTCATCTTCGTCTACCCCTTCACCA
CTGCCGTCGGCGATTCAAGAGGGCAGAGCCAGAGGATCGCCGCCGTCGCCCAGGAGCTCG
GATGGTACGCCCCGGACCTACTCAACGCCGCCACCGCCGACGACCACTCTATCCTCGACT
ATTAACCAAGGCCATACATATGCTTGCTTCATTATCTCTAGTCTGTACAAGTACAACTCG
TCCAAATTCATTCATCCATCCATCCATCCACGACACATATACAAATACTAATCTATTATT
ACTACTAAGTAGTACTAGTAGCCACCGATATATATACACAACAAATGTATTAATCAAAAT
GCTAATTTATT

CDS

774 bp

>Os01t0102300-01 Thylakoid lumen protein, Photosynthesis and chloroplast development
ATGACGTCATCATTATCATCATCCACAGCCTCTGCTGCTGCTTGTTGCAAGAGTAGAAGT
CGTAATCCTCCTCCGGCGCCGGCGCCACACACTAGTACTGCACGAGTAGTTCGCAGCAGC
AGGCGGAGGCTTCTCTTAGTATTCTTCTCCGCAGAGGCGGCGGCGGCTGCGACGAGCGGT
CTCATCCAGACCCCGTGTGGGCAAGCCTACCCTTTCGCTGGCACCAACGTGAAGAAGCCG
CAGCCGCCGTCCACCCCTTACTCCCAATCCCAATCGCAGCAGCAGTTTGGCCTCGACGCC
AAAGGGAGGATTAGGGCGTGCCCGTCGACGAACCCCGGATGCGTGTCCACAAACCCCACG
GTGGGCGCATCTTGCTCCTTGGCCTCCCCGCTCATCGTCCCCGCTAATACACCAACGGAC
AAGGCCGCCGCTTCGCTGCGCGAGGCTATCCTCAAGACGCAGAGGAATGCGGTGATCAAA
GCCGACGAGGAGACGGCGTACGGGCACTACATCCAGGCGGAGGTCGACGGCGGCGCAGGC
CGCGACGTGATGGAGTTCCTCCTCAAGGAATCCCAGTCCCAGTCCCAGGAGGTGGTGGCC
GCGTACCGATGCGTCGCCACCAAGGTCATCTTCGTCTACCCCTTCACCACTGCCGTCGGC
GATTCAAGAGGGCAGAGCCAGAGGATCGCCGCCGTCGCCCAGGAGCTCGGATGGTACGCC
CCGGACCTACTCAACGCCGCCACCGCCGACGACCACTCTATCCTCGACTATTAA

Protein

257 aa

>Os01t0102300-01 Thylakoid lumen protein, Photosynthesis and chloroplast development
MTSSLSSSTASAAACCKSRSRNPPPAPAPHTSTARVVRSSRRRLLLVFFSAEAAAAATSG
LIQTPCGQAYPFAGTNVKKPQPPSTPYSQSQSQQQFGLDAKGRIRACPSTNPGCVSTNPT
VGASCSLASPLIVPANTPTDKAAASLREAILKTQRNAVIKADEETAYGHYIQAEVDGGAG
RDVMEFLLKESQSQSQEVVAAYRCVATKVIFVYPFTTAVGDSRGQSQRIAAVAQELGWYA
PDLLNAATADDHSILDY*

5'UTR

chr01:134300..134310 (+ strand) : 11 bp

CDS

chr01:134311..134615 (+ strand) : 305 bp

chr01:134698..134824 (+ strand) : 127 bp

chr01:134912..135253 (+ strand) : 342 bp

3'UTR

chr01:135254..135439 (+ strand) : 186 bp

FASTA

>Os01t0102300-01 class=Sequence position=chr01:134300..135439 (+ strand)
GTACGTTTGT AATGACGTCA TCATTATCAT CATCCACAGC CTCTGCTGCT GCTTGTTGCA AGAGTAGAAG TCGTAATCCT
CCTCCGGCGC CGGCGCCACA CACTAGTACT GCACGAGTAG TTCGCAGCAG CAGGCGGAGG CTTCTCTTAG TATTCTTCTC
CGCAGAGGCG GCGGCGGCTG CGACGAGCGG TCTCATCCAG ACCCCGTGTG GGCAAGCCTA CCCTTTCGCT GGCACCAACG
TGAAGAAGCC GCAGCCGCCG TCCACCCCTT ACTCCCAATC CCAATCGCAG CAGCAGTTTG GCCTCGACGC CAAAGGGTAA
TTAACTAAAC CGGCCGCCAC AGATCTGGAT GGATCGATCT TAAAATTAAG AAAGAGATTA TATATATTAT GGATGCAGGA
GGATTAGGGC GTGCCCGTCG ACGAACCCCG GATGCGTGTC CACAAACCCC ACGGTGGGCG CATCTTGCTC CTTGGCCTCC
CCGCTCATCG TCCCCGCTAA TACACCAACG GACAAGGCCG CCGCTGTAAG TGTACGCACG CACGCATTTG TTATTCATTT
AATATAGCAG TATTTGTTTC TGAATTAGTA ATTCGATGTG AATGAATGAC AGTCGCTGCG CGAGGCTATC CTCAAGACGC
AGAGGAATGC GGTGATCAAA GCCGACGAGG AGACGGCGTA CGGGCACTAC ATCCAGGCGG AGGTCGACGG CGGCGCAGGC
CGCGACGTGA TGGAGTTCCT CCTCAAGGAA TCCCAGTCCC AGTCCCAGGA GGTGGTGGCC GCGTACCGAT GCGTCGCCAC
CAAGGTCATC TTCGTCTACC CCTTCACCAC TGCCGTCGGC GATTCAAGAG GGCAGAGCCA GAGGATCGCC GCCGTCGCCC
AGGAGCTCGG ATGGTACGCC CCGGACCTAC TCAACGCCGC CACCGCCGAC GACCACTCTA TCCTCGACTA TTAACCAAGG
CCATACATAT GCTTGCTTCA TTATCTCTAG TCTGTACAAG TACAACTCGT CCAAATTCAT TCATCCATCC ATCCATCCAC
GACACATATA CAAATACTAA TCTATTATTA CTACTAAGTA GTACTAGTAG CCACCGATAT ATATACACAA CAAATGTATT
AATCAAAATG CTAATTTATT 

Locus: Os01g0102300

Loading...

Locus: Os01g0102300

Loading...