Os01t0102400-01

Locus

Os01g0102400

Description

Histone-fold domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP5H

CGSNL Gene Name

HAP5H SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP5H, OsNF-YC9, NF-YC9, NFYC9

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit C9, NUCLEAR FACTOR-Y subunit NF-YC9, NF-YC transcription factor 9, NF-YC subunit 9, NF-YC family 9

Transcript Evidence

AK242226 (DDBJ, Best hit)

Protein Evidence

NP_001041748.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Histone-fold (IPR009072)

Full-length cDNA

J075175B02 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0102400-01)

Others

Oryzabase (20924)

KEGG (Os01t0102400-01)

Transcript

1517 bp

>Os01t0102400-01 Histone-fold domain containing protein.
GTGTCATATTGTGTTCATCTTCATACTACCAACCAATTAGTGCTAATAGGTAGCATTTTC
TGCAGTTGCAGCTCAAGTAAGGTCTATTATTCGGAGCAACAAAGGGAAGGAATGGAGCAA
ACTTTGGACGTACCTAGATCGTTGAGGCTACCGACACCAAAGGCTCAACAACAAATGGAT
GAATTTTGGAGGGATCGACAAAAAGAGATTGAGACAACAAAGGACTTTAGCGAGCATGCG
ATCCCTATGGCCCGCTTGAAGAAGATCGCATCTTCTCAAAAGGGTAACATGATGATGTCC
TTTGACATGCCAGCATTCTTATCGAAGATGTGTGAGCTCTTCGTACAAGAACTTGCTGTG
CGTGCATGGGCATCTGCTCAATCCCATAACCGTTGCATCATACTAGACACGGATATTGCT
GAAGCCATTGCCTCCACAGAGTCTTATGACTTTCTTGTTGATATCCTCCATAATCACCGT
GAGAAGCACAAATCCACTCCTTGTTCTACACTTACTACAAAGCGTTGTAGGTTAGTCGAT
CAACCTTCCACATCTCGCCCGCCCTACCAACATCAGCTGCCACTGTTTGCTCCTACATAT
ACTCCAGCCATCCCTATTACTCCTAGTTTAATGCCACCAATTTCTCACTATATACCGTTC
CAATATCCATCCTTATCACAAGAAGTGTCCACGATGATGGCTTCCGCACCCATAGTGAAT
AGATCAATGTTGCTCATTCACAACATAGCAAGGGGTCTAGGCTTACAAGGAAACAATATC
AGCACATTCGCCAACAATAATATCCCAGACAATATTATTGGTTGTAGTAGCCCCGCGGTT
CTTGCAAGTATGATGAGTCCTGCTTTACTAGACGTTGCAGGGGCATCACTAAATCCGCCA
AACTCTCACTCCATCTGCACGATGAACATGATCAACTCGAGTGATCCCAGTGGATCTAGC
ATTGGTGACATTAATGTTGCAAATCAAGCAAGTCTTGCTCCCTCTGAACATTTTAACCCT
GCTATCCTTCAAGAGTCCTCATGTCCTTCGTTCTTATATAATAACAACAATGACACGATT
GTTGTTGTACCGGAGGGTGTAGATATTAGTGGCACCATGGATGTTGCTGGTTTAGTTATC
AATGGTCAAGAAGAAGAACATGAGAGGAAAACAAATGTTGAGCAAAATGAGATATATGAA
AGCATTGATATAGGAATAATCAATGCAAGTGTTGCGGATGGTAATAAATGCAGTATTAGG
TGGGATGAATTAGGAACGGCCGATGATTCATTGCTAGATAAATTTTTGGAGGAGTTTCAA
GCAAGAAACGACGGTGTTTTGCACAGCGGGATTGTGTTGCATGAAGACCATTCCTAGGTG
ACGTGATTTTAGCAAACCCAAGTAGTAGCAATGCCAATATAAGTAATTGAGTTGGCAAGT
TTTGTTTATGTCTTTTGTAAGAATGAGGTTGTAACTCTTTTTCTTGTTGAATATAATGTT
GTTTGTTTGGAGAGAAG

CDS

1266 bp

>Os01t0102400-01 Histone-fold domain containing protein.
ATGGAGCAAACTTTGGACGTACCTAGATCGTTGAGGCTACCGACACCAAAGGCTCAACAA
CAAATGGATGAATTTTGGAGGGATCGACAAAAAGAGATTGAGACAACAAAGGACTTTAGC
GAGCATGCGATCCCTATGGCCCGCTTGAAGAAGATCGCATCTTCTCAAAAGGGTAACATG
ATGATGTCCTTTGACATGCCAGCATTCTTATCGAAGATGTGTGAGCTCTTCGTACAAGAA
CTTGCTGTGCGTGCATGGGCATCTGCTCAATCCCATAACCGTTGCATCATACTAGACACG
GATATTGCTGAAGCCATTGCCTCCACAGAGTCTTATGACTTTCTTGTTGATATCCTCCAT
AATCACCGTGAGAAGCACAAATCCACTCCTTGTTCTACACTTACTACAAAGCGTTGTAGG
TTAGTCGATCAACCTTCCACATCTCGCCCGCCCTACCAACATCAGCTGCCACTGTTTGCT
CCTACATATACTCCAGCCATCCCTATTACTCCTAGTTTAATGCCACCAATTTCTCACTAT
ATACCGTTCCAATATCCATCCTTATCACAAGAAGTGTCCACGATGATGGCTTCCGCACCC
ATAGTGAATAGATCAATGTTGCTCATTCACAACATAGCAAGGGGTCTAGGCTTACAAGGA
AACAATATCAGCACATTCGCCAACAATAATATCCCAGACAATATTATTGGTTGTAGTAGC
CCCGCGGTTCTTGCAAGTATGATGAGTCCTGCTTTACTAGACGTTGCAGGGGCATCACTA
AATCCGCCAAACTCTCACTCCATCTGCACGATGAACATGATCAACTCGAGTGATCCCAGT
GGATCTAGCATTGGTGACATTAATGTTGCAAATCAAGCAAGTCTTGCTCCCTCTGAACAT
TTTAACCCTGCTATCCTTCAAGAGTCCTCATGTCCTTCGTTCTTATATAATAACAACAAT
GACACGATTGTTGTTGTACCGGAGGGTGTAGATATTAGTGGCACCATGGATGTTGCTGGT
TTAGTTATCAATGGTCAAGAAGAAGAACATGAGAGGAAAACAAATGTTGAGCAAAATGAG
ATATATGAAAGCATTGATATAGGAATAATCAATGCAAGTGTTGCGGATGGTAATAAATGC
AGTATTAGGTGGGATGAATTAGGAACGGCCGATGATTCATTGCTAGATAAATTTTTGGAG
GAGTTTCAAGCAAGAAACGACGGTGTTTTGCACAGCGGGATTGTGTTGCATGAAGACCAT
TCCTAG

Protein

422 aa

>Os01t0102400-01 Histone-fold domain containing protein.
MEQTLDVPRSLRLPTPKAQQQMDEFWRDRQKEIETTKDFSEHAIPMARLKKIASSQKGNM
MMSFDMPAFLSKMCELFVQELAVRAWASAQSHNRCIILDTDIAEAIASTESYDFLVDILH
NHREKHKSTPCSTLTTKRCRLVDQPSTSRPPYQHQLPLFAPTYTPAIPITPSLMPPISHY
IPFQYPSLSQEVSTMMASAPIVNRSMLLIHNIARGLGLQGNNISTFANNNIPDNIIGCSS
PAVLASMMSPALLDVAGASLNPPNSHSICTMNMINSSDPSGSSIGDINVANQASLAPSEH
FNPAILQESSCPSFLYNNNNDTIVVVPEGVDISGTMDVAGLVINGQEEEHERKTNVEQNE
IYESIDIGIINASVADGNKCSIRWDELGTADDSLLDKFLEEFQARNDGVLHSGIVLHEDH
S*

5'UTR

chr01:139826..139906 (+ strand) : 81 bp

chr01:140120..140149 (+ strand) : 30 bp

CDS

chr01:140150..141415 (+ strand) : 1266 bp

3'UTR

chr01:141416..141555 (+ strand) : 140 bp

FASTA

>Os01t0102400-01 class=Sequence position=chr01:139826..141555 (+ strand)
GTGTCATATT GTGTTCATCT TCATACTACC AACCAATTAG TGCTAATAGG TAGCATTTTC TGCAGTTGCA GCTCAAGTAA
GGTAATGCAC CTACTAGCTT ATTATTCTTG TGCCTAGTAT TAATTAGTTT CTATACTGGT ACTTGTGAAA ATTTGTGATT
TGAGCGATGC TATTTGATTT GTAATTAAGC TAGCTATCTC TTTTTTCTTG GACCGCAATG TAACATCGTG TTGCTAACTT
TTAAACTATA AAAGTAAGAT AAAGAAGTAA CAAAAGTGTG TGCTTGCTAT GTAGGTCTAT TATTCGGAGC AACAAAGGGA
AGGAATGGAG CAAACTTTGG ACGTACCTAG ATCGTTGAGG CTACCGACAC CAAAGGCTCA ACAACAAATG GATGAATTTT
GGAGGGATCG ACAAAAAGAG ATTGAGACAA CAAAGGACTT TAGCGAGCAT GCGATCCCTA TGGCCCGCTT GAAGAAGATC
GCATCTTCTC AAAAGGGTAA CATGATGATG TCCTTTGACA TGCCAGCATT CTTATCGAAG ATGTGTGAGC TCTTCGTACA
AGAACTTGCT GTGCGTGCAT GGGCATCTGC TCAATCCCAT AACCGTTGCA TCATACTAGA CACGGATATT GCTGAAGCCA
TTGCCTCCAC AGAGTCTTAT GACTTTCTTG TTGATATCCT CCATAATCAC CGTGAGAAGC ACAAATCCAC TCCTTGTTCT
ACACTTACTA CAAAGCGTTG TAGGTTAGTC GATCAACCTT CCACATCTCG CCCGCCCTAC CAACATCAGC TGCCACTGTT
TGCTCCTACA TATACTCCAG CCATCCCTAT TACTCCTAGT TTAATGCCAC CAATTTCTCA CTATATACCG TTCCAATATC
CATCCTTATC ACAAGAAGTG TCCACGATGA TGGCTTCCGC ACCCATAGTG AATAGATCAA TGTTGCTCAT TCACAACATA
GCAAGGGGTC TAGGCTTACA AGGAAACAAT ATCAGCACAT TCGCCAACAA TAATATCCCA GACAATATTA TTGGTTGTAG
TAGCCCCGCG GTTCTTGCAA GTATGATGAG TCCTGCTTTA CTAGACGTTG CAGGGGCATC ACTAAATCCG CCAAACTCTC
ACTCCATCTG CACGATGAAC ATGATCAACT CGAGTGATCC CAGTGGATCT AGCATTGGTG ACATTAATGT TGCAAATCAA
GCAAGTCTTG CTCCCTCTGA ACATTTTAAC CCTGCTATCC TTCAAGAGTC CTCATGTCCT TCGTTCTTAT ATAATAACAA
CAATGACACG ATTGTTGTTG TACCGGAGGG TGTAGATATT AGTGGCACCA TGGATGTTGC TGGTTTAGTT ATCAATGGTC
AAGAAGAAGA ACATGAGAGG AAAACAAATG TTGAGCAAAA TGAGATATAT GAAAGCATTG ATATAGGAAT AATCAATGCA
AGTGTTGCGG ATGGTAATAA ATGCAGTATT AGGTGGGATG AATTAGGAAC GGCCGATGAT TCATTGCTAG ATAAATTTTT
GGAGGAGTTT CAAGCAAGAA ACGACGGTGT TTTGCACAGC GGGATTGTGT TGCATGAAGA CCATTCCTAG GTGACGTGAT
TTTAGCAAAC CCAAGTAGTA GCAATGCCAA TATAAGTAAT TGAGTTGGCA AGTTTTGTTT ATGTCTTTTG TAAGAATGAG
GTTGTAACTC TTTTTCTTGT TGAATATAAT GTTGTTTGTT TGGAGAGAAG