Os01t0102800-01

Locus

Os01g0102800

Description

Similar to chromatin remodeling complex subunit.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

CSB, OsCBS

Oryzabase Gene Name Synonym(s)

Cockayne syndrome WD-repeat protein

Transcript Evidence

AK064456 (DDBJ, Best hit)

Protein Evidence

XP_002307656.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: helicase activity (GO:0004386)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

SNF2-related (IPR000330)

Helicase, C-terminal (IPR001650)

DEAD-like helicase (IPR014001)

Full-length cDNA

002-110-F11 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0102800-01)

RiceXPro (AK064456)

Others

Oryzabase (18092)

KEGG (Os01t0102800-01)

Transcript

2990 bp

>Os01t0102800-01 Similar to chromatin remodeling complex subunit.
TAAGCTAGATGCACCTGCTGCCCCATTTCAGAGACTTGGAAAACCCCTAAAGCGTCCTGT
CTCTCCCAGTTCAGATGAGCAGGAAAAGAAGAGACCAAGAAATAAGACCAAAAGACCACT
GCCTGGCAAGAAATGGAGGAAAGCAAACTCAATTAAGGAATCATCATTGGATGACAACGA
TGTTGGAGAGGCAGCTGTGTCAGTTTCAGATGATGATGAAGATCAAGTTACAGAAGGCTC
TGATGAGTTAACTGATGTTACCCTTGAAGGAGGTTTGAGAATTCCTGGCACACTTTACAC
GCAACTATTTGACTACCAGAAAGTGGGAGTGCAGTGGCTATGGGAGTTGCATTGTCAAAG
GGCTGGTGGAATAATTGGAGATGAAATGGGCCTGGGAAAGACTGTGCAGGTCTTGTCATT
TCTTGGTTCCTTGCATAACAGTGGGCTCTACAAGCCTAGCATTGTTGTTTGTCCTGTAAC
CCTTTTGCAACAGTGGCGAAGGGAGGCCAGTAGATGGTATCCAAAGTTCAAGGTTGAGAT
CTTACATGACTCTGCAAACAGTTCATCTAAAAAGAGCAAGAGGTCTAGTGATTCTGACAG
TGAAGCTTCCTGGGATAGTGATCAGGAAGAAGCGGTTACATGTTCAAAACCTGCAAAGAA
GTGGGATGACTTGATTTCACGTGTTGTGAGTTCAGGATCAGGTTTGCTTCTGACCACATA
TGAGCAGTTAAGGATCCTAGGGGAGAAGTTGCTTGATATAGAATGGGGATATGCTGTATT
GGATGAGGGTCACCGCATTAGGAATCCTAATGCTGAGATTACTCTTGTGTGCAAGCAATT
GCAGACCGTGCACAGGATAATTATGACAGGTGCACCTATTCAAAACAAACTTTCGGAGCT
TTGGTCTCTCTTTGATTTTGTGTTCCCTGGAAAACTAGGTGTCCTGCCTGTGTTTGAGGC
TGAGTTTTCTGTTCCAATTACTGTTGGTGGGTACGCTAATGCAACACCATTGCAAGTGTC
CACGGCGTATCGATGTGCTGTTGTCCTACGTGACCTGGTCATGCCGTACCTTCTTAGAAG
AATGAAAGCTGATGTCAATGCACAGCTTCCCAAGAAAACAGAGCATGTTCTTTTCTGTAG
TCTAACTACTGAGCAACGTGCTACTTATCGTGCATTTCTTGCTAGTTCGGAGGTGGAACA
AATCTTTGATGGTAACAGAAATTCCCTTTATGGGATAGATGTTCTAAGGAAGATATGCAA
TCATCCTGATCTACTTGAGAGAGAACATGCTGCTCAGAATCCTGACTATGGGAATCCTGA
AAGAAGTGGAAAGATGAAAGTGGTTGAGCAAGTTCTTAAAGTATGGAAAGAACAAGGTCA
TCGTGTTCTTCTTTTCACTCAGACACAACAAATGCTTGACATTATGGAGAACTTCTTGAC
AGCTTGCGAATACCAATACCGAAGAATGGATGGACTTACACCTGCAAAGCAAAGAATGGC
ACTTATTGATGAATTCAATAACACAGATGAAATTTTTATTTTCATTCTGACCACGAAAGT
TGGTGGACTGGGTACGAATTTGACTGGTGCAAACCGGATTATTATATATGATCCTGACTG
GAATCCTTCAACTGACATGCAGgctagggaacgtgcatggcgaattgggcaaactagaga
tgtgacagtttatagactgatcacgcgtgggacaatagaggagaaagtctaccatcgtca
gatatacaagcatttcctcacaaacaaagtactgaaagaccctcagcagaggcggttttt
taaagccagagacatgaaggatttgtttacgctgcaagatgatgacaataatggctcaac
tgaaacatcaaatattttcagccaattgtctgaggatgtgaatatcggagttccgagtga
caagcaacaagaccagctatatgcagcctctgctacaccgacaacctctgggactgaacc
gagctcatccaggcatggacagggtaaagaagaccattgccctgaccaagcagatgaaga
atgcaacattttgaagagcctttttgatgctcaaggcattcatagtgcgatcaatcatga
tgccataatgaacgctaatgatgaccagaagctgcgcctagaagcagaagctacacaggt
ggcacaaagggcagctgaagctttacgccaatcacggatgctcagaagtcatgaaagttt
ttctgttcctacatggactggaagagctgGTGCTGCGGGGGCACCATCCTCTGTCCGCAG
GAAGTTTGGGTCAACACTCAATACCCAGTTGGTTAATTCTTCTCAGCCATCAGAAACTTC
AAATGGCAGGGGCCAAAGTCTTCAGGTGGGTGCTCTAAATGGCAAAGCACTGTCCTCCGC
TGAGCTTCTGGCCAGGATACGTGGAACCCGAGAGGGAGCAGCTTCAGATGCACTAGAACA
TCAACTCAACCTGGGATCAGCTTCCAATCACACATCGAGTTCATCAGGGAATGGCCGTGC
ATCAAGCTCTTCTACTAGGAGCATGATCGTACAGCCTGAAGTCCTAATCCGCCAATTGTG
CACCTTCATACAGCAGCATGGTGGTTCCGCCAGCTCAACAAGTATAACTGAACACTTCAA
GAACCGGATACTGTCCAAGGATATGCTGCTGTTTAAGAATCTGCTGAAGGAAATAGCTAC
GTTGCAAAGAGGTGCAAATGGTGCAACGTGGGTGCTGAAACCTGACTACCAGTAATATTA
GCTATAGCTGCAAAGTTTTGGCTAGGTGTAGCGAACAGCATAAATTAATTTCATTCAGAT
TGGAGATGCAAAAATCGATGAGGGAAATGCCTCTAATGCCTTTTTGATGAAGACTGAATT
CTTTTTGTAGGCAATATACAACTTTTGTAGGGTAGATATACAAATCTGAAACAAAAACAT
GTAGGTGACAGGTTGTAAATGCATGAATACAGACATTTGTCGCTGGAAGC

CDS

2754 bp

>Os01t0102800-01 Similar to chromatin remodeling complex subunit.
AAGCTAGATGCACCTGCTGCCCCATTTCAGAGACTTGGAAAACCCCTAAAGCGTCCTGTC
TCTCCCAGTTCAGATGAGCAGGAAAAGAAGAGACCAAGAAATAAGACCAAAAGACCACTG
CCTGGCAAGAAATGGAGGAAAGCAAACTCAATTAAGGAATCATCATTGGATGACAACGAT
GTTGGAGAGGCAGCTGTGTCAGTTTCAGATGATGATGAAGATCAAGTTACAGAAGGCTCT
GATGAGTTAACTGATGTTACCCTTGAAGGAGGTTTGAGAATTCCTGGCACACTTTACACG
CAACTATTTGACTACCAGAAAGTGGGAGTGCAGTGGCTATGGGAGTTGCATTGTCAAAGG
GCTGGTGGAATAATTGGAGATGAAATGGGCCTGGGAAAGACTGTGCAGGTCTTGTCATTT
CTTGGTTCCTTGCATAACAGTGGGCTCTACAAGCCTAGCATTGTTGTTTGTCCTGTAACC
CTTTTGCAACAGTGGCGAAGGGAGGCCAGTAGATGGTATCCAAAGTTCAAGGTTGAGATC
TTACATGACTCTGCAAACAGTTCATCTAAAAAGAGCAAGAGGTCTAGTGATTCTGACAGT
GAAGCTTCCTGGGATAGTGATCAGGAAGAAGCGGTTACATGTTCAAAACCTGCAAAGAAG
TGGGATGACTTGATTTCACGTGTTGTGAGTTCAGGATCAGGTTTGCTTCTGACCACATAT
GAGCAGTTAAGGATCCTAGGGGAGAAGTTGCTTGATATAGAATGGGGATATGCTGTATTG
GATGAGGGTCACCGCATTAGGAATCCTAATGCTGAGATTACTCTTGTGTGCAAGCAATTG
CAGACCGTGCACAGGATAATTATGACAGGTGCACCTATTCAAAACAAACTTTCGGAGCTT
TGGTCTCTCTTTGATTTTGTGTTCCCTGGAAAACTAGGTGTCCTGCCTGTGTTTGAGGCT
GAGTTTTCTGTTCCAATTACTGTTGGTGGGTACGCTAATGCAACACCATTGCAAGTGTCC
ACGGCGTATCGATGTGCTGTTGTCCTACGTGACCTGGTCATGCCGTACCTTCTTAGAAGA
ATGAAAGCTGATGTCAATGCACAGCTTCCCAAGAAAACAGAGCATGTTCTTTTCTGTAGT
CTAACTACTGAGCAACGTGCTACTTATCGTGCATTTCTTGCTAGTTCGGAGGTGGAACAA
ATCTTTGATGGTAACAGAAATTCCCTTTATGGGATAGATGTTCTAAGGAAGATATGCAAT
CATCCTGATCTACTTGAGAGAGAACATGCTGCTCAGAATCCTGACTATGGGAATCCTGAA
AGAAGTGGAAAGATGAAAGTGGTTGAGCAAGTTCTTAAAGTATGGAAAGAACAAGGTCAT
CGTGTTCTTCTTTTCACTCAGACACAACAAATGCTTGACATTATGGAGAACTTCTTGACA
GCTTGCGAATACCAATACCGAAGAATGGATGGACTTACACCTGCAAAGCAAAGAATGGCA
CTTATTGATGAATTCAATAACACAGATGAAATTTTTATTTTCATTCTGACCACGAAAGTT
GGTGGACTGGGTACGAATTTGACTGGTGCAAACCGGATTATTATATATGATCCTGACTGG
AATCCTTCAACTGACATGCAGgctagggaacgtgcatggcgaattgggcaaactagagat
gtgacagtttatagactgatcacgcgtgggacaatagaggagaaagtctaccatcgtcag
atatacaagcatttcctcacaaacaaagtactgaaagaccctcagcagaggcggtttttt
aaagccagagacatgaaggatttgtttacgctgcaagatgatgacaataatggctcaact
gaaacatcaaatattttcagccaattgtctgaggatgtgaatatcggagttccgagtgac
aagcaacaagaccagctatatgcagcctctgctacaccgacaacctctgggactgaaccg
agctcatccaggcatggacagggtaaagaagaccattgccctgaccaagcagatgaagaa
tgcaacattttgaagagcctttttgatgctcaaggcattcatagtgcgatcaatcatgat
gccataatgaacgctaatgatgaccagaagctgcgcctagaagcagaagctacacaggtg
gcacaaagggcagctgaagctttacgccaatcacggatgctcagaagtcatgaaagtttt
tctgttcctacatggactggaagagctgGTGCTGCGGGGGCACCATCCTCTGTCCGCAGG
AAGTTTGGGTCAACACTCAATACCCAGTTGGTTAATTCTTCTCAGCCATCAGAAACTTCA
AATGGCAGGGGCCAAAGTCTTCAGGTGGGTGCTCTAAATGGCAAAGCACTGTCCTCCGCT
GAGCTTCTGGCCAGGATACGTGGAACCCGAGAGGGAGCAGCTTCAGATGCACTAGAACAT
CAACTCAACCTGGGATCAGCTTCCAATCACACATCGAGTTCATCAGGGAATGGCCGTGCA
TCAAGCTCTTCTACTAGGAGCATGATCGTACAGCCTGAAGTCCTAATCCGCCAATTGTGC
ACCTTCATACAGCAGCATGGTGGTTCCGCCAGCTCAACAAGTATAACTGAACACTTCAAG
AACCGGATACTGTCCAAGGATATGCTGCTGTTTAAGAATCTGCTGAAGGAAATAGCTACG
TTGCAAAGAGGTGCAAATGGTGCAACGTGGGTGCTGAAACCTGACTACCAGTAA

Protein

917 aa

>Os01t0102800-01 Similar to chromatin remodeling complex subunit.
KLDAPAAPFQRLGKPLKRPVSPSSDEQEKKRPRNKTKRPLPGKKWRKANSIKESSLDDND
VGEAAVSVSDDDEDQVTEGSDELTDVTLEGGLRIPGTLYTQLFDYQKVGVQWLWELHCQR
AGGIIGDEMGLGKTVQVLSFLGSLHNSGLYKPSIVVCPVTLLQQWRREASRWYPKFKVEI
LHDSANSSSKKSKRSSDSDSEASWDSDQEEAVTCSKPAKKWDDLISRVVSSGSGLLLTTY
EQLRILGEKLLDIEWGYAVLDEGHRIRNPNAEITLVCKQLQTVHRIIMTGAPIQNKLSEL
WSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANATPLQVSTAYRCAVVLRDLVMPYLLRR
MKADVNAQLPKKTEHVLFCSLTTEQRATYRAFLASSEVEQIFDGNRNSLYGIDVLRKICN
HPDLLEREHAAQNPDYGNPERSGKMKVVEQVLKVWKEQGHRVLLFTQTQQMLDIMENFLT
ACEYQYRRMDGLTPAKQRMALIDEFNNTDEIFIFILTTKVGGLGTNLTGANRIIIYDPDW
NPSTDMQARERAWRIGQTRDVTVYRLITRGTIEEKVYHRQIYKHFLTNKVLKDPQQRRFF
KARDMKDLFTLQDDDNNGSTETSNIFSQLSEDVNIGVPSDKQQDQLYAASATPTTSGTEP
SSSRHGQGKEDHCPDQADEECNILKSLFDAQGIHSAINHDAIMNANDDQKLRLEAEATQV
AQRAAEALRQSRMLRSHESFSVPTWTGRAGAAGAPSSVRRKFGSTLNTQLVNSSQPSETS
NGRGQSLQVGALNGKALSSAELLARIRGTREGAASDALEHQLNLGSASNHTSSSSGNGRA
SSSSTRSMIVQPEVLIRQLCTFIQQHGGSASSTSITEHFKNRILSKDMLLFKNLLKEIAT
LQRGANGATWVLKPDYQ*

5'UTR

chr01:152853..152853 (+ strand) : 1 bp

CDS

chr01:152854..153025 (+ strand) : 172 bp

chr01:153178..154646 (+ strand) : 1469 bp

chr01:155010..155450 (+ strand) : 441 bp

chr01:155543..156214 (+ strand) : 672 bp

3'UTR

chr01:156215..156449 (+ strand) : 235 bp

FASTA

>Os01t0102800-01 class=Sequence position=chr01:152853..156449 (+ strand)
TAAGCTAGAT GCACCTGCTG CCCCATTTCA GAGACTTGGA AAACCCCTAA AGCGTCCTGT CTCTCCCAGT TCAGATGAGC
AGGAAAAGAA GAGACCAAGA AATAAGACCA AAAGACCACT GCCTGGCAAG AAATGGAGGA AAGCAAACTC AATTAAGGAA
TCATCATTGG ATGGTAAGTC AAGGGTTCTT CACAGCTTGT AGGCTTTCCT GTTATTGTAC ATACAGTTGC ACTTTCAAAA
GGAATACTCT ATCTGCTTCT CTGTATAACA CTCTTTGGGT GAGATCACTG CTCTGAACAT ATTGTTCTAC TTTCTGAACT
TACAGACAAC GATGTTGGAG AGGCAGCTGT GTCAGTTTCA GATGATGATG AAGATCAAGT TACAGAAGGC TCTGATGAGT
TAACTGATGT TACCCTTGAA GGAGGTTTGA GAATTCCTGG CACACTTTAC ACGCAACTAT TTGACTACCA GAAAGTGGGA
GTGCAGTGGC TATGGGAGTT GCATTGTCAA AGGGCTGGTG GAATAATTGG AGATGAAATG GGCCTGGGAA AGACTGTGCA
GGTCTTGTCA TTTCTTGGTT CCTTGCATAA CAGTGGGCTC TACAAGCCTA GCATTGTTGT TTGTCCTGTA ACCCTTTTGC
AACAGTGGCG AAGGGAGGCC AGTAGATGGT ATCCAAAGTT CAAGGTTGAG ATCTTACATG ACTCTGCAAA CAGTTCATCT
AAAAAGAGCA AGAGGTCTAG TGATTCTGAC AGTGAAGCTT CCTGGGATAG TGATCAGGAA GAAGCGGTTA CATGTTCAAA
ACCTGCAAAG AAGTGGGATG ACTTGATTTC ACGTGTTGTG AGTTCAGGAT CAGGTTTGCT TCTGACCACA TATGAGCAGT
TAAGGATCCT AGGGGAGAAG TTGCTTGATA TAGAATGGGG ATATGCTGTA TTGGATGAGG GTCACCGCAT TAGGAATCCT
AATGCTGAGA TTACTCTTGT GTGCAAGCAA TTGCAGACCG TGCACAGGAT AATTATGACA GGTGCACCTA TTCAAAACAA
ACTTTCGGAG CTTTGGTCTC TCTTTGATTT TGTGTTCCCT GGAAAACTAG GTGTCCTGCC TGTGTTTGAG GCTGAGTTTT
CTGTTCCAAT TACTGTTGGT GGGTACGCTA ATGCAACACC ATTGCAAGTG TCCACGGCGT ATCGATGTGC TGTTGTCCTA
CGTGACCTGG TCATGCCGTA CCTTCTTAGA AGAATGAAAG CTGATGTCAA TGCACAGCTT CCCAAGAAAA CAGAGCATGT
TCTTTTCTGT AGTCTAACTA CTGAGCAACG TGCTACTTAT CGTGCATTTC TTGCTAGTTC GGAGGTGGAA CAAATCTTTG
ATGGTAACAG AAATTCCCTT TATGGGATAG ATGTTCTAAG GAAGATATGC AATCATCCTG ATCTACTTGA GAGAGAACAT
GCTGCTCAGA ATCCTGACTA TGGGAATCCT GAAAGAAGTG GAAAGATGAA AGTGGTTGAG CAAGTTCTTA AAGTATGGAA
AGAACAAGGT CATCGTGTTC TTCTTTTCAC TCAGACACAA CAAATGCTTG ACATTATGGA GAACTTCTTG ACAGCTTGCG
AATACCAATA CCGAAGAATG GATGGACTTA CACCTGCAAA GCAAAGAATG GCACTTATTG ATGAATTCAA TAACACAGAT
GAAATTTTTA TTTTCATTCT GACCACGAAA GTTGGTGGAC TGGGTACGAA TTTGACTGGT GCAAACCGGA TTATTATATA
TGATCCTGAC TGGAATCCTT CAACTGACAT GCAGGTACTG TTTATGTAAG AGTATTGTAC TGCCAGTCTC TATATTTTTC
TTTAATTCTG CAAATTGTTT CAATATTTCT CCCAAAGCAT TTTCAAAACT CTAAGAAGGT TCTAAATAAC TGTCTTAATT
TACTTAAATA AAATGTCGAC TTCGAAAAAC tgcatgccag tgatagatta cctggcagat gaataatttg taccatagtc
tactgatact gttgctggct tagtaatgcc ttgtgattta ttcattaaat tttggattat atatttatat cttgttttat
ctttaaaaga aaatatctct gcaaagttgc atttatctaa attaccatgc taacaagatt aaattctcta tggttaggct
agggaacgtg catggcgaat tgggcaaact agagatgtga cagtttatag actgatcacg cgtgggacaa tagaggagaa
agtctaccat cgtcagatat acaagcattt cctcacaaac aaagtactga aagaccctca gcagaggcgg ttttttaaag
ccagagacat gaaggatttg tttacgctgc aagatgatga caataatggc tcaactgaaa catcaaatat tttcagccaa
ttgtctgagg atgtgaatat cggagttccg agtgacaagc aacaagacca gctatatgca gcctctgcta caccgacaac
ctctgggact gaaccgagct catccaggca tggacagggt aaagaagacc attgccctga ccaagcagat gaagaatgca
acattttgaa gagccttttt gatgctcaag gcattcatgt aagcaatatt ttttttatct ctttaaggca aattagctgc
ctcaattttt gtttctaaaa aatgatacac tcttttttgg acttcctcag agtgcgatca atcatgatgc cataatgaac
gctaatgatg accagaagct gcgcctagaa gcagaagcta cacaggtggc acaaagggca gctgaagctt tacgccaatc
acggatgctc agaagtcatg aaagtttttc tgttcctaca tggactggaa gagctgGTGC TGCGGGGGCA CCATCCTCTG
TCCGCAGGAA GTTTGGGTCA ACACTCAATA CCCAGTTGGT TAATTCTTCT CAGCCATCAG AAACTTCAAA TGGCAGGGGC
CAAAGTCTTC AGGTGGGTGC TCTAAATGGC AAAGCACTGT CCTCCGCTGA GCTTCTGGCC AGGATACGTG GAACCCGAGA
GGGAGCAGCT TCAGATGCAC TAGAACATCA ACTCAACCTG GGATCAGCTT CCAATCACAC ATCGAGTTCA TCAGGGAATG
GCCGTGCATC AAGCTCTTCT ACTAGGAGCA TGATCGTACA GCCTGAAGTC CTAATCCGCC AATTGTGCAC CTTCATACAG
CAGCATGGTG GTTCCGCCAG CTCAACAAGT ATAACTGAAC ACTTCAAGAA CCGGATACTG TCCAAGGATA TGCTGCTGTT
TAAGAATCTG CTGAAGGAAA TAGCTACGTT GCAAAGAGGT GCAAATGGTG CAACGTGGGT GCTGAAACCT GACTACCAGT
AATATTAGCT ATAGCTGCAA AGTTTTGGCT AGGTGTAGCG AACAGCATAA ATTAATTTCA TTCAGATTGG AGATGCAAAA
ATCGATGAGG GAAATGCCTC TAATGCCTTT TTGATGAAGA CTGAATTCTT TTTGTAGGCA ATATACAACT TTTGTAGGGT
AGATATACAA ATCTGAAACA AAAACATGTA GGTGACAGGT TGTAAATGCA TGAATACAGA CATTTGTCGC TGGAAGC

Locus: Os01g0102800

Loading...

Locus: Os01g0102800

Loading...