Os01t0103100-01

Locus

Os01g0103100

Description

Nitrate transporter, Regulation of nitrogen use efficiency (NUE)

RAP-DB Gene Symbol Synonym(s)

OsNPF6.1

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NPF6.1

CGSNL Gene Name

NITRATE TRANSPORTER 1/PEPTIDE TRANSPORTER 6.1

Oryzabase Gene Symbol Synonym(s)

OsNPF6.1

Oryzabase Gene Name Synonym(s)

NRT1/PTR family protein 6.1

Transcript Evidence

AK070557

Protein Evidence

Q9FTZ3

Literature

PMID: 31754193

Note

Manual Curation

December 11, 2019

Gene Ontology (GO)

Biological Process: oligopeptide transport (GO:0006857)

Biological Process: transmembrane transport (GO:0055085)

Molecular Function: transmembrane transporter activity (GO:0022857)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

MFS transporter superfamily (IPR036259)

Proton-dependent oligopeptide transporter family (IPR000109)

PTR2 family proton/oligopeptide symporter, conserved site (IPR018456)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

J023061L16 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0103100-01)

RiceXPro (AK070557)

Others

Oryzabase (23441)

KEGG (Os01t0103100-01)

Transcript

1942 bp

>Os01t0103100-01 Nitrate transporter, Regulation of nitrogen use efficiency (NUE)
GCTTGCTTCTTCCATATTGATCGAGGAGACATCACATGGATCATCATCCAATTCCAGCAG
ATGAGAATGAGATGACTAGTACTAGTCCCCAGATGCAGATGAGGAGAAACAAGCTCTCCT
CCCACTTCCAAGGAGATATCGATGATGATGGTGGTGTTGGTGTTGTGGACATCCGGGGGT
CGCCGATGGGGTCGGCGGAGCTGGCGCGCACCGGCGGGTGGGTGGCGGCGGTCTTCATCT
TCGGGAACGAGATGGCGGAGAGGATGGCCTACTACGGCCTGTCCCTCAACATGGTCATCT
TCATGTTCAACGTCATGCACCGCCCCTTCGCCGCCTCCGCCAACGCCGTGAACAACTTCC
TCGGCATCTCCCAGGCCTCCTCCCTCCTCGGCGGCTTCCTCGCCGACGCCTACCTCGGGC
GCTACTGGACCATCGCCGCCTTCACCACCCTCTATCTCCTGGGCCTCGTGGCCCTCACCC
TCTGCGCCACCATGCCCGCCCTCCAGGCCCCGGGCCAGGACGAGTGCGACGGCTTCGCCA
AGCTGCTGGGCAAGTGCCAGCAGCCGCACCCCTGGCAGATGGCCTACCTCTACGCCGCGC
TCTACACCACCGCCTTGGGCGCCGCCGGGATCCGCCCCTGCGTCTCCTCCTTCGGGGCGG
ACCAGTTCGAGGAGCGGAGCCCGGTGCTGGACCGCTTCTTCAACCTCTTCTACCTGGCCG
TCACCGTGGGCGCCATCGCGGCCTTCACGCTGCTGGTGTACGTGCAGAGGAACCACGGGT
GGGCGGCGGCGTTCGGGGCGCTGGCGCTGGCCATGGCCGCATCCAACGCGCTCTTCTTCA
TGGGGACGCCGCTGTACCGCCACCGCGTGCCGGGGGGAAGCCCGCTGACGAGGGTGGCGC
AGGTGCTAGTGGCGGCCTACAGGAAGCGTCACATCAAGCACACCACGGAACTGTTGTACG
AGGTGGGCGGGGCCAAGTCGGCGGTGCGCGGGAGCGGCAAGATCGAGCACACGGAGGAGC
TGAGGTGGCTGGACAAGGCGGCGGTGAGGGTGGAGGGCCAAGAAGAAATCAATAACCCAT
GGCGTCTTTGCACTGTGACCCAGGTGGAGGAGGTGAAGATCCTGGTGCGGCTGGCGCCGG
TGTCGGCGTGCACGGTGATGCTGAGCGTGGTGCTGACGGAGTTCCTGACGCTGTCGGTGC
AGCAGGCGTACACCCTCAACACCAGGGGCCTCCCCGTGGCGTGCATGCCCGTCTTCCCCT
GCCTCGCCATCCTCCTCCTCCTCGCCCTCTACTACAGGGCCTTCGCCCCGCTCGCCCGCC
GCCTCACCGGCCACCCGCACGGCGCCTCCCAGCTGCAGCGCCTCGGCCTCGGCCTCCTCC
TCTCCACCCTCTCCGTCGCTTGGGCTGGCCTCTTCGAGCGCTACCGCCGCGCCTACGCCA
TCCGCCATGGCTTCCTCCCGCTCTTCCTCACTCCCATGCCGGGCCTCAGCGCCTACTGGC
TCCTCATCCAGTACTGCCTCATCGGTCTCGCCGAGGTCTTCTGCCTCGTCGCCCTCCTCG
AGTTCCTCTACCAGGAGGCCCCCGACGCCATGCGCAGCCTCGCCTCCGCCTACGCCGCCC
TCGCCGGCGGCCTTGGCTGCTTCTTAGCCACCGCCATCAACACCGCCGTCGACTCCATCA
CCGGCGACATCGACGCCGGACGCCCCTCCTGGCTCGCGCAGAACATCAACGTCGGCAAGT
TCGACTACTTCTACTGGCTCCTCGCCGTGCTCAGCACCATCAACCTCATCGTCTTCATCT
ACTTCGCCAAAGCCTACAAGTACAGGATCAAGCCCCCCACCACCCCACATAACTAGTTCA
TAGTATTTCTACACCACTACAGTCTAGTACTAGTAGTATCTGCTAAGTGACATTATATTG
ATCAATCAAACAAATTAAGGGC

CDS

1821 bp

>Os01t0103100-01 Nitrate transporter, Regulation of nitrogen use efficiency (NUE)
ATGGATCATCATCCAATTCCAGCAGATGAGAATGAGATGACTAGTACTAGTCCCCAGATG
CAGATGAGGAGAAACAAGCTCTCCTCCCACTTCCAAGGAGATATCGATGATGATGGTGGT
GTTGGTGTTGTGGACATCCGGGGGTCGCCGATGGGGTCGGCGGAGCTGGCGCGCACCGGC
GGGTGGGTGGCGGCGGTCTTCATCTTCGGGAACGAGATGGCGGAGAGGATGGCCTACTAC
GGCCTGTCCCTCAACATGGTCATCTTCATGTTCAACGTCATGCACCGCCCCTTCGCCGCC
TCCGCCAACGCCGTGAACAACTTCCTCGGCATCTCCCAGGCCTCCTCCCTCCTCGGCGGC
TTCCTCGCCGACGCCTACCTCGGGCGCTACTGGACCATCGCCGCCTTCACCACCCTCTAT
CTCCTGGGCCTCGTGGCCCTCACCCTCTGCGCCACCATGCCCGCCCTCCAGGCCCCGGGC
CAGGACGAGTGCGACGGCTTCGCCAAGCTGCTGGGCAAGTGCCAGCAGCCGCACCCCTGG
CAGATGGCCTACCTCTACGCCGCGCTCTACACCACCGCCTTGGGCGCCGCCGGGATCCGC
CCCTGCGTCTCCTCCTTCGGGGCGGACCAGTTCGAGGAGCGGAGCCCGGTGCTGGACCGC
TTCTTCAACCTCTTCTACCTGGCCGTCACCGTGGGCGCCATCGCGGCCTTCACGCTGCTG
GTGTACGTGCAGAGGAACCACGGGTGGGCGGCGGCGTTCGGGGCGCTGGCGCTGGCCATG
GCCGCATCCAACGCGCTCTTCTTCATGGGGACGCCGCTGTACCGCCACCGCGTGCCGGGG
GGAAGCCCGCTGACGAGGGTGGCGCAGGTGCTAGTGGCGGCCTACAGGAAGCGTCACATC
AAGCACACCACGGAACTGTTGTACGAGGTGGGCGGGGCCAAGTCGGCGGTGCGCGGGAGC
GGCAAGATCGAGCACACGGAGGAGCTGAGGTGGCTGGACAAGGCGGCGGTGAGGGTGGAG
GGCCAAGAAGAAATCAATAACCCATGGCGTCTTTGCACTGTGACCCAGGTGGAGGAGGTG
AAGATCCTGGTGCGGCTGGCGCCGGTGTCGGCGTGCACGGTGATGCTGAGCGTGGTGCTG
ACGGAGTTCCTGACGCTGTCGGTGCAGCAGGCGTACACCCTCAACACCAGGGGCCTCCCC
GTGGCGTGCATGCCCGTCTTCCCCTGCCTCGCCATCCTCCTCCTCCTCGCCCTCTACTAC
AGGGCCTTCGCCCCGCTCGCCCGCCGCCTCACCGGCCACCCGCACGGCGCCTCCCAGCTG
CAGCGCCTCGGCCTCGGCCTCCTCCTCTCCACCCTCTCCGTCGCTTGGGCTGGCCTCTTC
GAGCGCTACCGCCGCGCCTACGCCATCCGCCATGGCTTCCTCCCGCTCTTCCTCACTCCC
ATGCCGGGCCTCAGCGCCTACTGGCTCCTCATCCAGTACTGCCTCATCGGTCTCGCCGAG
GTCTTCTGCCTCGTCGCCCTCCTCGAGTTCCTCTACCAGGAGGCCCCCGACGCCATGCGC
AGCCTCGCCTCCGCCTACGCCGCCCTCGCCGGCGGCCTTGGCTGCTTCTTAGCCACCGCC
ATCAACACCGCCGTCGACTCCATCACCGGCGACATCGACGCCGGACGCCCCTCCTGGCTC
GCGCAGAACATCAACGTCGGCAAGTTCGACTACTTCTACTGGCTCCTCGCCGTGCTCAGC
ACCATCAACCTCATCGTCTTCATCTACTTCGCCAAAGCCTACAAGTACAGGATCAAGCCC
CCCACCACCCCACATAACTAG

Protein

606 aa

>Os01t0103100-01 Nitrate transporter, Regulation of nitrogen use efficiency (NUE)
MDHHPIPADENEMTSTSPQMQMRRNKLSSHFQGDIDDDGGVGVVDIRGSPMGSAELARTG
GWVAAVFIFGNEMAERMAYYGLSLNMVIFMFNVMHRPFAASANAVNNFLGISQASSLLGG
FLADAYLGRYWTIAAFTTLYLLGLVALTLCATMPALQAPGQDECDGFAKLLGKCQQPHPW
QMAYLYAALYTTALGAAGIRPCVSSFGADQFEERSPVLDRFFNLFYLAVTVGAIAAFTLL
VYVQRNHGWAAAFGALALAMAASNALFFMGTPLYRHRVPGGSPLTRVAQVLVAAYRKRHI
KHTTELLYEVGGAKSAVRGSGKIEHTEELRWLDKAAVRVEGQEEINNPWRLCTVTQVEEV
KILVRLAPVSACTVMLSVVLTEFLTLSVQQAYTLNTRGLPVACMPVFPCLAILLLLALYY
RAFAPLARRLTGHPHGASQLQRLGLGLLLSTLSVAWAGLFERYRRAYAIRHGFLPLFLTP
MPGLSAYWLLIQYCLIGLAEVFCLVALLEFLYQEAPDAMRSLASAYAALAGGLGCFLATA
INTAVDSITGDIDAGRPSWLAQNINVGKFDYFYWLLAVLSTINLIVFIYFAKAYKYRIKP
PTTPHN*

5'UTR

chr01:178607..178641 (+ strand) : 35 bp

CDS

chr01:178642..180462 (+ strand) : 1821 bp

3'UTR

chr01:180463..180548 (+ strand) : 86 bp

FASTA

>Os01t0103100-01 class=Sequence position=chr01:178607..180548 (+ strand)
GCTTGCTTCT TCCATATTGA TCGAGGAGAC ATCACATGGA TCATCATCCA ATTCCAGCAG ATGAGAATGA GATGACTAGT
ACTAGTCCCC AGATGCAGAT GAGGAGAAAC AAGCTCTCCT CCCACTTCCA AGGAGATATC GATGATGATG GTGGTGTTGG
TGTTGTGGAC ATCCGGGGGT CGCCGATGGG GTCGGCGGAG CTGGCGCGCA CCGGCGGGTG GGTGGCGGCG GTCTTCATCT
TCGGGAACGA GATGGCGGAG AGGATGGCCT ACTACGGCCT GTCCCTCAAC ATGGTCATCT TCATGTTCAA CGTCATGCAC
CGCCCCTTCG CCGCCTCCGC CAACGCCGTG AACAACTTCC TCGGCATCTC CCAGGCCTCC TCCCTCCTCG GCGGCTTCCT
CGCCGACGCC TACCTCGGGC GCTACTGGAC CATCGCCGCC TTCACCACCC TCTATCTCCT GGGCCTCGTG GCCCTCACCC
TCTGCGCCAC CATGCCCGCC CTCCAGGCCC CGGGCCAGGA CGAGTGCGAC GGCTTCGCCA AGCTGCTGGG CAAGTGCCAG
CAGCCGCACC CCTGGCAGAT GGCCTACCTC TACGCCGCGC TCTACACCAC CGCCTTGGGC GCCGCCGGGA TCCGCCCCTG
CGTCTCCTCC TTCGGGGCGG ACCAGTTCGA GGAGCGGAGC CCGGTGCTGG ACCGCTTCTT CAACCTCTTC TACCTGGCCG
TCACCGTGGG CGCCATCGCG GCCTTCACGC TGCTGGTGTA CGTGCAGAGG AACCACGGGT GGGCGGCGGC GTTCGGGGCG
CTGGCGCTGG CCATGGCCGC ATCCAACGCG CTCTTCTTCA TGGGGACGCC GCTGTACCGC CACCGCGTGC CGGGGGGAAG
CCCGCTGACG AGGGTGGCGC AGGTGCTAGT GGCGGCCTAC AGGAAGCGTC ACATCAAGCA CACCACGGAA CTGTTGTACG
AGGTGGGCGG GGCCAAGTCG GCGGTGCGCG GGAGCGGCAA GATCGAGCAC ACGGAGGAGC TGAGGTGGCT GGACAAGGCG
GCGGTGAGGG TGGAGGGCCA AGAAGAAATC AATAACCCAT GGCGTCTTTG CACTGTGACC CAGGTGGAGG AGGTGAAGAT
CCTGGTGCGG CTGGCGCCGG TGTCGGCGTG CACGGTGATG CTGAGCGTGG TGCTGACGGA GTTCCTGACG CTGTCGGTGC
AGCAGGCGTA CACCCTCAAC ACCAGGGGCC TCCCCGTGGC GTGCATGCCC GTCTTCCCCT GCCTCGCCAT CCTCCTCCTC
CTCGCCCTCT ACTACAGGGC CTTCGCCCCG CTCGCCCGCC GCCTCACCGG CCACCCGCAC GGCGCCTCCC AGCTGCAGCG
CCTCGGCCTC GGCCTCCTCC TCTCCACCCT CTCCGTCGCT TGGGCTGGCC TCTTCGAGCG CTACCGCCGC GCCTACGCCA
TCCGCCATGG CTTCCTCCCG CTCTTCCTCA CTCCCATGCC GGGCCTCAGC GCCTACTGGC TCCTCATCCA GTACTGCCTC
ATCGGTCTCG CCGAGGTCTT CTGCCTCGTC GCCCTCCTCG AGTTCCTCTA CCAGGAGGCC CCCGACGCCA TGCGCAGCCT
CGCCTCCGCC TACGCCGCCC TCGCCGGCGG CCTTGGCTGC TTCTTAGCCA CCGCCATCAA CACCGCCGTC GACTCCATCA
CCGGCGACAT CGACGCCGGA CGCCCCTCCT GGCTCGCGCA GAACATCAAC GTCGGCAAGT TCGACTACTT CTACTGGCTC
CTCGCCGTGC TCAGCACCAT CAACCTCATC GTCTTCATCT ACTTCGCCAA AGCCTACAAG TACAGGATCA AGCCCCCCAC
CACCCCACAT AACTAGTTCA TAGTATTTCT ACACCACTAC AGTCTAGTAC TAGTAGTATC TGCTAAGTGA CATTATATTG
ATCAATCAAA CAAATTAAGG GC

Locus: Os01g0103100

Loading...

Locus: Os01g0103100

Loading...