Os01t0103100-02

Locus

Os01g0103100

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NPF6.1

CGSNL Gene Name

NITRATE TRANSPORTER 1/PEPTIDE TRANSPORTER 6.1

Oryzabase Gene Symbol Synonym(s)

OsNPF6.1

Oryzabase Gene Name Synonym(s)

NRT1/PTR family protein 6.1

Transcript Evidence

AK058723 (DDBJ, Best hit)

Protein Evidence

XP_002873609.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oligopeptide transport (GO:0006857)

Cellular Component: membrane (GO:0016020)

Molecular Function: transporter activity (GO:0005215)

Functional domain (InterPro)

Oligopeptide transporter (IPR000109)

Major facilitator superfamily domain, general substrate transporter (IPR016196)

PTR2 family proton/oligopeptide symporter, conserved site (IPR018456)

Full-length cDNA

001-019-E11 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0103100-02)

RiceXPro (AK058723)

Others

Oryzabase (23441)

KEGG (Os01t0103100-02)

Transcript

1924 bp

>Os01t0103100-02 Similar to predicted protein.
ATCCAATTCCAGCAGATGAGAATGAGATGACTAGTACTAGTCCCCAGATGCAGATGAGGA
GAAACAAGCTCTCCTCCCACTTCCAAGGAGATATCGATGATGATGGTGGTGTTGGTGTTG
TGGACATCCGGGGGTCGCCGATGGGGTCGGCGGAGCTGGCGCGCACCGGCGGGTGGGTGG
CGGCGGTCTTCATCTTCGGGAACGAGATGGCGGAGAGGATGGCCTACTACGGCCTGTCCC
TCAACATGGTCATCTTCATGTTCAACGTCATGCACCGCCCCTTCGCCGCCTCCGCCAACG
CCGTGAACAACTTCCTCGGCATCTCCCAGGCCTCCTCCCTCCTCGGCGGCTTCCTCGCCG
ACGCCTACCTCGGGCGCTACTGGACCATCGCCGCCTTCACCACCCTCTATCTCCTGGGCC
TCGTGGCCCTCACCCTCTGCGCCACCATGCCCGCCCTCCAGGCCCCGGGCCAGGACGAGT
GCGACGGCTTCGCCAAGCTGCTGGGCAAGTGCCAGCAGCCGCACCCCTGGCAGATGGCCT
ACCTCTACGCCGCGCTCTACACCACCGCCTTGGGCGCCGCCGGGATCCGCCCCTGCGTCT
CCTCCTTCGGGGCGGACCAGTTCGAGGAGCGGAGCCCGGTGCTGGACCGCTTCTTCAACC
TCTTCTACCTGGCCGTCACCGTGGGCGCCATCGCGGCCTTCACGCTGCTGGTGTACGTGC
AGAGGAACCACGGGTGGGCGGCGGCGTTCGGGGCGCTGGCGCTGGCCATGGCCGCATCCA
ACGCGCTCTTCTTCATGGGGACGCCGCTGTACCGCCACCGCGTGCCGGGGGGAAGCCCGC
TGACGAGGGTGGCGCAGGTGCTAGTGGCGGCCTACAGGAAGCGTCACATCAAGCACACCA
CGGAACTGTTGTACGAGGTGGGCGGGGCCAAGTCGGCGGTGCGCGGGAGCGGCAAGATCG
AGCACACGGAGGAGCTGAGGTGGCTGGACAAGGCGGCGGTGAGGGTGGAGGGCCAAGAAG
AAATCAATAACCCATGGCGTCTTTGCACTGTGACCCAGGTGGAGGAGGTGAAGATCCTGG
TGCGGCTGGCGCCGGTGTCGGCGTGCACGGTGATGCTGAGCGTGGTGCTGACGGAGTTCC
TGACGCTGTCGGTGCAGCAGGCGTACACCCTCAACACCAGGGGCCTCCCCGTGGCGTGCA
TGCCCGTCTTCCCCTGCCTCGCCATCCTCCTCCTCCTCGCCCTCTACTACAGGGCCTTCG
CCCCGCTCGCCCGCCGCCTCACCGGCCACCCGCACGGCGCCTCCCAGCTGCAGCGCCTCG
GCCTCGGCCTCCTCCTCTCCACCCTCTCCGTCGCTTGGGCTGGCCTCTTCGAGCGCTACC
GCCGCGCCTACGCCATCCGCCATGGCTTCCTCCCGCTCTTCCTCACTCCCATGCCGGGCC
TCAGCGCCTACTGGCTCCTCATCCAGTACTGCCTCATCGGTCTCGCCGAGGTCTTCTGCC
TCGTCGCCCTCCTCGAGTTCCTCTACCAGGAGGCCCCCGACGCCATGCGCAGCCTCGCCT
CCGCCTACGCCGCCCTCGCCGGCGGCCTTGGCTGCTTCTTAGCCACCGCCATCAACACCG
CCGTCGACTCCATCACCGGCGACATCGACGCCGGACGCCCCTCCTGGCTCGCGCAGAACA
TCAACGTCGGCAAGTTCGACTACTTCTACTGGCTCCTCGCCGTGCTCAGCACCATCAACC
TCATCGTCTTCATCTACTTCGCCAAAGCCTACAAGTACAGGATCAAGCCCCCCACCACCC
CACATAACTAGTTCATAGTATTTCTACACCACTACAGTCTAGTACTAGTAGTATCTGCTA
AGTGACATTATATTGATCAATCAAACAAATTAAGGGCATCCAATATCTTCTTTTTTATTG
ATCT

CDS

1785 bp

>Os01t0103100-02 Similar to predicted protein.
ATGACTAGTACTAGTCCCCAGATGCAGATGAGGAGAAACAAGCTCTCCTCCCACTTCCAA
GGAGATATCGATGATGATGGTGGTGTTGGTGTTGTGGACATCCGGGGGTCGCCGATGGGG
TCGGCGGAGCTGGCGCGCACCGGCGGGTGGGTGGCGGCGGTCTTCATCTTCGGGAACGAG
ATGGCGGAGAGGATGGCCTACTACGGCCTGTCCCTCAACATGGTCATCTTCATGTTCAAC
GTCATGCACCGCCCCTTCGCCGCCTCCGCCAACGCCGTGAACAACTTCCTCGGCATCTCC
CAGGCCTCCTCCCTCCTCGGCGGCTTCCTCGCCGACGCCTACCTCGGGCGCTACTGGACC
ATCGCCGCCTTCACCACCCTCTATCTCCTGGGCCTCGTGGCCCTCACCCTCTGCGCCACC
ATGCCCGCCCTCCAGGCCCCGGGCCAGGACGAGTGCGACGGCTTCGCCAAGCTGCTGGGC
AAGTGCCAGCAGCCGCACCCCTGGCAGATGGCCTACCTCTACGCCGCGCTCTACACCACC
GCCTTGGGCGCCGCCGGGATCCGCCCCTGCGTCTCCTCCTTCGGGGCGGACCAGTTCGAG
GAGCGGAGCCCGGTGCTGGACCGCTTCTTCAACCTCTTCTACCTGGCCGTCACCGTGGGC
GCCATCGCGGCCTTCACGCTGCTGGTGTACGTGCAGAGGAACCACGGGTGGGCGGCGGCG
TTCGGGGCGCTGGCGCTGGCCATGGCCGCATCCAACGCGCTCTTCTTCATGGGGACGCCG
CTGTACCGCCACCGCGTGCCGGGGGGAAGCCCGCTGACGAGGGTGGCGCAGGTGCTAGTG
GCGGCCTACAGGAAGCGTCACATCAAGCACACCACGGAACTGTTGTACGAGGTGGGCGGG
GCCAAGTCGGCGGTGCGCGGGAGCGGCAAGATCGAGCACACGGAGGAGCTGAGGTGGCTG
GACAAGGCGGCGGTGAGGGTGGAGGGCCAAGAAGAAATCAATAACCCATGGCGTCTTTGC
ACTGTGACCCAGGTGGAGGAGGTGAAGATCCTGGTGCGGCTGGCGCCGGTGTCGGCGTGC
ACGGTGATGCTGAGCGTGGTGCTGACGGAGTTCCTGACGCTGTCGGTGCAGCAGGCGTAC
ACCCTCAACACCAGGGGCCTCCCCGTGGCGTGCATGCCCGTCTTCCCCTGCCTCGCCATC
CTCCTCCTCCTCGCCCTCTACTACAGGGCCTTCGCCCCGCTCGCCCGCCGCCTCACCGGC
CACCCGCACGGCGCCTCCCAGCTGCAGCGCCTCGGCCTCGGCCTCCTCCTCTCCACCCTC
TCCGTCGCTTGGGCTGGCCTCTTCGAGCGCTACCGCCGCGCCTACGCCATCCGCCATGGC
TTCCTCCCGCTCTTCCTCACTCCCATGCCGGGCCTCAGCGCCTACTGGCTCCTCATCCAG
TACTGCCTCATCGGTCTCGCCGAGGTCTTCTGCCTCGTCGCCCTCCTCGAGTTCCTCTAC
CAGGAGGCCCCCGACGCCATGCGCAGCCTCGCCTCCGCCTACGCCGCCCTCGCCGGCGGC
CTTGGCTGCTTCTTAGCCACCGCCATCAACACCGCCGTCGACTCCATCACCGGCGACATC
GACGCCGGACGCCCCTCCTGGCTCGCGCAGAACATCAACGTCGGCAAGTTCGACTACTTC
TACTGGCTCCTCGCCGTGCTCAGCACCATCAACCTCATCGTCTTCATCTACTTCGCCAAA
GCCTACAAGTACAGGATCAAGCCCCCCACCACCCCACATAACTAG

Protein

594 aa

>Os01t0103100-02 Similar to predicted protein.
MTSTSPQMQMRRNKLSSHFQGDIDDDGGVGVVDIRGSPMGSAELARTGGWVAAVFIFGNE
MAERMAYYGLSLNMVIFMFNVMHRPFAASANAVNNFLGISQASSLLGGFLADAYLGRYWT
IAAFTTLYLLGLVALTLCATMPALQAPGQDECDGFAKLLGKCQQPHPWQMAYLYAALYTT
ALGAAGIRPCVSSFGADQFEERSPVLDRFFNLFYLAVTVGAIAAFTLLVYVQRNHGWAAA
FGALALAMAASNALFFMGTPLYRHRVPGGSPLTRVAQVLVAAYRKRHIKHTTELLYEVGG
AKSAVRGSGKIEHTEELRWLDKAAVRVEGQEEINNPWRLCTVTQVEEVKILVRLAPVSAC
TVMLSVVLTEFLTLSVQQAYTLNTRGLPVACMPVFPCLAILLLLALYYRAFAPLARRLTG
HPHGASQLQRLGLGLLLSTLSVAWAGLFERYRRAYAIRHGFLPLFLTPMPGLSAYWLLIQ
YCLIGLAEVFCLVALLEFLYQEAPDAMRSLASAYAALAGGLGCFLATAINTAVDSITGDI
DAGRPSWLAQNINVGKFDYFYWLLAVLSTINLIVFIYFAKAYKYRIKPPTTPHN*

5'UTR

chr01:178652..178677 (+ strand) : 26 bp

CDS

chr01:178678..180462 (+ strand) : 1785 bp

3'UTR

chr01:180463..180575 (+ strand) : 113 bp

FASTA

>Os01t0103100-02 class=Sequence position=chr01:178652..180575 (+ strand)
ATCCAATTCC AGCAGATGAG AATGAGATGA CTAGTACTAG TCCCCAGATG CAGATGAGGA GAAACAAGCT CTCCTCCCAC
TTCCAAGGAG ATATCGATGA TGATGGTGGT GTTGGTGTTG TGGACATCCG GGGGTCGCCG ATGGGGTCGG CGGAGCTGGC
GCGCACCGGC GGGTGGGTGG CGGCGGTCTT CATCTTCGGG AACGAGATGG CGGAGAGGAT GGCCTACTAC GGCCTGTCCC
TCAACATGGT CATCTTCATG TTCAACGTCA TGCACCGCCC CTTCGCCGCC TCCGCCAACG CCGTGAACAA CTTCCTCGGC
ATCTCCCAGG CCTCCTCCCT CCTCGGCGGC TTCCTCGCCG ACGCCTACCT CGGGCGCTAC TGGACCATCG CCGCCTTCAC
CACCCTCTAT CTCCTGGGCC TCGTGGCCCT CACCCTCTGC GCCACCATGC CCGCCCTCCA GGCCCCGGGC CAGGACGAGT
GCGACGGCTT CGCCAAGCTG CTGGGCAAGT GCCAGCAGCC GCACCCCTGG CAGATGGCCT ACCTCTACGC CGCGCTCTAC
ACCACCGCCT TGGGCGCCGC CGGGATCCGC CCCTGCGTCT CCTCCTTCGG GGCGGACCAG TTCGAGGAGC GGAGCCCGGT
GCTGGACCGC TTCTTCAACC TCTTCTACCT GGCCGTCACC GTGGGCGCCA TCGCGGCCTT CACGCTGCTG GTGTACGTGC
AGAGGAACCA CGGGTGGGCG GCGGCGTTCG GGGCGCTGGC GCTGGCCATG GCCGCATCCA ACGCGCTCTT CTTCATGGGG
ACGCCGCTGT ACCGCCACCG CGTGCCGGGG GGAAGCCCGC TGACGAGGGT GGCGCAGGTG CTAGTGGCGG CCTACAGGAA
GCGTCACATC AAGCACACCA CGGAACTGTT GTACGAGGTG GGCGGGGCCA AGTCGGCGGT GCGCGGGAGC GGCAAGATCG
AGCACACGGA GGAGCTGAGG TGGCTGGACA AGGCGGCGGT GAGGGTGGAG GGCCAAGAAG AAATCAATAA CCCATGGCGT
CTTTGCACTG TGACCCAGGT GGAGGAGGTG AAGATCCTGG TGCGGCTGGC GCCGGTGTCG GCGTGCACGG TGATGCTGAG
CGTGGTGCTG ACGGAGTTCC TGACGCTGTC GGTGCAGCAG GCGTACACCC TCAACACCAG GGGCCTCCCC GTGGCGTGCA
TGCCCGTCTT CCCCTGCCTC GCCATCCTCC TCCTCCTCGC CCTCTACTAC AGGGCCTTCG CCCCGCTCGC CCGCCGCCTC
ACCGGCCACC CGCACGGCGC CTCCCAGCTG CAGCGCCTCG GCCTCGGCCT CCTCCTCTCC ACCCTCTCCG TCGCTTGGGC
TGGCCTCTTC GAGCGCTACC GCCGCGCCTA CGCCATCCGC CATGGCTTCC TCCCGCTCTT CCTCACTCCC ATGCCGGGCC
TCAGCGCCTA CTGGCTCCTC ATCCAGTACT GCCTCATCGG TCTCGCCGAG GTCTTCTGCC TCGTCGCCCT CCTCGAGTTC
CTCTACCAGG AGGCCCCCGA CGCCATGCGC AGCCTCGCCT CCGCCTACGC CGCCCTCGCC GGCGGCCTTG GCTGCTTCTT
AGCCACCGCC ATCAACACCG CCGTCGACTC CATCACCGGC GACATCGACG CCGGACGCCC CTCCTGGCTC GCGCAGAACA
TCAACGTCGG CAAGTTCGAC TACTTCTACT GGCTCCTCGC CGTGCTCAGC ACCATCAACC TCATCGTCTT CATCTACTTC
GCCAAAGCCT ACAAGTACAG GATCAAGCCC CCCACCACCC CACATAACTA GTTCATAGTA TTTCTACACC ACTACAGTCT
AGTACTAGTA GTATCTGCTA AGTGACATTA TATTGATCAA TCAAACAAAT TAAGGGCATC CAATATCTTC TTTTTTATTG
ATCT

Locus: Os01g0103100

Loading...

Locus: Os01g0103100

Loading...