Os01t0103700-01

Locus

Os01g0103700

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK070525 (DDBJ, Best hit)

Protein Evidence

B9ETK1 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

J023061E16 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0103700-01)

Transcript

3481 bp

>Os01t0103700-01 Conserved hypothetical protein.
AAGTAGAAAGAAACACAAGAAGAAGAAGAAGGGTTACCGGCGGGCGGCGGCGGCCATGGC
CATGCAATGGAGCATCGACCTCGACAGGGCTCTCCGCTCCCGCCACCCCACCCCGGTCAG
TACTGGTCAACGCGGCATTGTTTGCGGCTGGCTGTTTTTAGGCTATCAGTGGATTTCTCT
TACATTACACTTGAAGCACTTCCAAGGTTGGAAAGCAGATCGTTCTGGGCACGTTGGAAG
ATAATTTCAAAGCTGACATGCTCTTGTCACTCTCAAGATTGGCATCCAAGTCAGTTCTTC
TGTTTGGCGATCAGGTGGAATTGCTGTTATTGTTCCTGGAGCATGAATCTTCTCATTGCA
TGAAGACCGTGTCATTGAAATGTTTATGTTTTATGTTTCACGGAAGCATCTGCCATTTTC
CTGTTTTAAGGACTGTTTTTGGAACGTTATTACAGCTAATTGATGATGATGATTTCCCAC
TTGATTGTAAGAGAGATGCATTTACGGTTCTTCAAAAGATAGTCTGTGGCAAAGCTCCAA
TTGTTCATTTTGTCGATACTTCTGAGCTATCTAAGCTTGTTCTGGCTGCTGAGAGTTCTT
TGCATTCTTCTTCCTGGGAGATGCAAGGAAGGTTCATCATTGACTTACAATGGGTGTCAA
GGGATTACCAGCAACTTCCTGTCAACTCATGTAGAAAATGATGAGGACAAATTCGTGCAT
AAGATTGTAACATCAATGGTGAATCATAATATATCTCTGGTCAATCAAATAATAAGCACT
GGAAACAAGGAAGCAACAAGGAGACATACTTATATGTCCTCTGAATTCAAGATGTACAGA
TCTATGTTAAGCAGTATGCTAAAACTTCTTGTGTGCTACCCCTTCTGCTGCTGCTGTTGC
TCTTGATAAACTAAGAGGCCTGATAAAAGAACTAGCCCGACTAGATGACAGTGATTGCTC
CAAAGTTTCTGTTGCCAATGTTGAATCATTTCAAACATATTCTGCCCGTGAAGTACTTGG
CACTTCAAATGATATTAAGCCAGAGACTGCTAGTGTGATGGCTTCTCACATGGGAGCAGA
TTTTGATAAGTTAAAATTCGACCCAACTGAATTTAGTAGCAAGAAGGAAGTATTTATAGT
GCGTAATATAATTCTTTCGACACTCAAGTTTGCAAATACTTGTCATAATATGCTTTCTAA
AACTCCTGGTGCTAGCTGCAATCTTTATGATAGAATCAAGGAGCTGATTGAGTGTGTGCA
GCAGAATGCTTCTCAGTATTGTAGCACATACGAATTTTTCCATCTGATAATGTGTGCTTG
TATTTCATGGTATGCTTGTAAAACTAGAGATGGCAATCAAGAATCAGGTGATCCAACAGA
ACAGCCTGACATATTCTCTAGTCCTTCTATTTGGTTAACTCAGGAGCTCTGTGCGATTCG
GATAACAAAAATGCTTTTCAGAAAGCAGAGGTATTGGGATGCCTATATGTCTGCTATGTA
CTGTTGTCGTGAAGGCCTCTGGTTTGTGGTGTCGTTTGTCTTTAGAAAACTTGCAGATGA
TTTTGGGTCAGGCTCTTTCAGTTTTTGGTTCAAATCATTGCTGCTTATTTCAGCTGGAGA
AATTGAGATGAAGCTACTGCTTTTCCCTTCAGCAATCATTAAGTTGGTCAGTGAGCTTAA
AACAGATTGCGATCTTCATGAGAGTTTTTACTGTGTTGAAACAAATGTTGACAGTAGTCT
TGCTGGCTCTTCAGAGTTGCATGGTTCCCAAGCAAAGATTACTGATATTTGCAGCAAAAC
ATTCTTAGCTACTGATCACCTCTTATCGAATACCTCTTCAAGTCATGAGCTGTTTTTCCA
GAGGTGGTTTATTAGTCTCAGGGCATCGTTTCTTGAGATCCTAGCAGATTTTCTTGGTAT
CCTTACTGCACATTTAACTGATCAGAGAGATGAATCTCATCATGATGCTATTGGAGACCA
TTCCAGTGTACCTAGAGAGCATAATAACAGCCAATTACTTGCTTTGGTGAATTGTTCATT
ACGATTAAGTGAACTGGCACATAGTTATGATCTACTTGCTGTATCCCATGGGGACATGGA
TCGCCAAAGTTTTTCTAGCATAGCCAGGCTTGCTTTCATGTGCTCACTTCTGGCATTTTG
TATTGCATTTTCTGTGGATTTCTCAAAGGTACATAGTAGTGTGGAGTCTTGCAGGCTTCC
AGAGAGGTTTTCTCACGCTTCAGTTGTACAAGATTTACATGAAAGAGTGGATAGGACTGA
TAGCCAAATTGTTTCACAACTGCAACAATTAATGCCCATTTGTTGTGATAAAGTGCACTC
CATACAGATTGTCACAAGAATGAATTGTGAATTGTTCAGGTATTCTGGAAAAGGATTCTT
ATCGTCTTTGCAAATTTGCTGTGGCATATTTCCTCCGCTTACGTGGGGACACCAAAGGAA
TAGCGACTGGAGAGGACAGTGTATCTCCTTTGCATGGAGGGATGCAATTTCTGTCCAGCA
TTTTACAGAGGGTTATGGAATTGCCATTTGTTCTACCCAAATACTTCTTCAGAGTAAGGT
AACGTATGCGTGTTGTTCTCTTAAAATTAGTTGTTGTGGATGAGAAGTTCACCATGCTGG
ATCACTTAATTTTTTTTTCACAAGCCACATGTGCCTATTTAATACATAGATGATCGCAGA
GTTTTATTTTATGTATATCTCACTATTCCTCTCTGAAATTTGTGTTTCAGTAATGCATCG
CTCGAATAGATATCTGTAATAATGGTTAGCTTGTTTACTATATATCTTGCAGGCCTTGCT
TTGGTGCTGAACTTCATATATATGATTCAAATCCAGAAAACAGAGACGGGATATCAGTAC
CAAGTGGCCTCCAGCTTTCCCTAACCCTTTGCTTGCAGTGGAAATGTGTGTTAGGAGTAA
CATTGATATCTCGAAGCTACTCGAAGCTATACTGCGTTTTAGCTGCAAGCTCAGCATCCT
GCTGCTTAGATGCAACAGGAACAAGAAGCAAAGAGTTTGAGATACACAAGAAAACTGCTG
GAATGGTTGGTCTTAATACCAAGCTGATGCAGTACATAGAGGATGATTTGAGAAAGAAGA
GGGAGAAGAAGAGGAAAAAGGTCCGTGTGGAGGAGAAGGAAATGGTGACAGCATTTGCGC
GTTTCGAAGCAAGTGACAGTGGGATGGGATTCTCTAGCTACCTGCTGGATGTGTCTGAAT
TTCCTCAAGGTTCATACAAGATGAAGTGGCATGCGTGCTGCATCGACAAAGATGGCGCCT
ATTATAGCTTGCTGCCTCTCAACGACGGCGCAGCCTTCTCCGTTCGCAAGTCTTGACAGC
CTTAGACATCTCTTGTTAACTTATAATCGTCGCAACTAGATTACTAGACTAGTGTTTTTG
TATTTAGAGACAAACAAATTGCATTACAACAAGACTTGTTAGTAGCATATGTTTCATGCT
G

CDS

507 bp

>Os01t0103700-01 Conserved hypothetical protein.
AGCACTTCCAAGGTTGGAAAGCAGATCGTTCTGGGCACGTTGGAAGATAATTTCAAAGCT
GACATGCTCTTGTCACTCTCAAGATTGGCATCCAAGTCAGTTCTTCTGTTTGGCGATCAG
GTGGAATTGCTGTTATTGTTCCTGGAGCATGAATCTTCTCATTGCATGAAGACCGTGTCA
TTGAAATGTTTATGTTTTATGTTTCACGGAAGCATCTGCCATTTTCCTGTTTTAAGGACT
GTTTTTGGAACGTTATTACAGCTAATTGATGATGATGATTTCCCACTTGATTGTAAGAGA
GATGCATTTACGGTTCTTCAAAAGATAGTCTGTGGCAAAGCTCCAATTGTTCATTTTGTC
GATACTTCTGAGCTATCTAAGCTTGTTCTGGCTGCTGAGAGTTCTTTGCATTCTTCTTCC
TGGGAGATGCAAGGAAGGTTCATCATTGACTTACAATGGGTGTCAAGGGATTACCAGCAA
CTTCCTGTCAACTCATGTAGAAAATGA

Protein

168 aa

>Os01t0103700-01 Conserved hypothetical protein.
STSKVGKQIVLGTLEDNFKADMLLSLSRLASKSVLLFGDQVELLLLFLEHESSHCMKTVS
LKCLCFMFHGSICHFPVLRTVFGTLLQLIDDDDFPLDCKRDAFTVLQKIVCGKAPIVHFV
DTSELSKLVLAAESSLHSSSWEMQGRFIIDLQWVSRDYQQLPVNSCRK*

5'UTR

chr01:191037..191161 (+ strand) : 125 bp

chr01:191625..191693 (+ strand) : 69 bp

CDS

chr01:191694..191705 (+ strand) : 12 bp

chr01:192399..192506 (+ strand) : 108 bp

chr01:192958..193161 (+ strand) : 204 bp

chr01:193248..193356 (+ strand) : 109 bp

chr01:193434..193507 (+ strand) : 74 bp

3'UTR

chr01:193508..196287 (+ strand) : 2780 bp

FASTA

>Os01t0103700-01 class=Sequence position=chr01:191037..196287 (+ strand)
AAGTAGAAAG AAACACAAGA AGAAGAAGAA GGGTTACCGG CGGGCGGCGG CGGCCATGGC CATGCAATGG AGCATCGACC
TCGACAGGGC TCTCCGCTCC CGCCACCCCA CCCCGGTCAG TACTGGTACA GCTACCCCTC AGCAATCTCA GTCAATCTAA
TCTCCCTAGC ATGCAGCCAC GCCATCGACG CTAGCTATTG CCCCTCGTCT CCGGGACCTC GGACCTAGCT TCTTCGCCCC
CCGCCTTGGG CCTCCGAACC GCGCCTCTTC GCCCACACCA TCCTCCTCCG CCTCCTCGCC ACCCACTTCA CCACCGCCCA
CAACGCCCGC ATCCTCCGCG CCCTCCTCCT CCTTCGCCGC AGCATGTGTG CAGGAACCCA GGCCGCCTAC CACGCTGCCT
GCCCCCAGGC CAGGGCACTC GCGCTGCGGA TGTTCGCCCA CCAAAGCCCT GCATATCCGC TCTCTCATTC TCTCCACCTT
CTCTTCCTCC AATGCACGGC GCCACTGGTC TATTTCTTTC TTTACCATTT ACCACTACAC CAGCGCAAAG TTTAGACACC
ACTAATTATT ATGCTTATCA TTTCGCAGGT CAACGCGGCA TTGTTTGCGG CTGGCTGTTT TTAGGCTATC AGTGGATTTC
TCTTACATTA CACTTGAAGC ACTTCCAAGG TTAATAATTG CTTCACCAAC AACACAAGCT CAAATTATCA TGGCAGCAAT
TAAGATTTTC CCCAAGCTTG ACTGTACTGT ACGTTGCCTG TTATCCATAG AGTTCATGAG GTGTTAATGG ATATATGTGT
GCTTCTTGGT TAAATTCGAT TTTTTTTTAC TCTTAAGTTG GCCAACATTT GCATTGCTTG TTCACTTCTT ACATACGAGG
CATCATTCAT TGGTTTAACA ATAGATACCT ATCAATCATG TGCACATACT CCAGTCCAAG GAATCATAAA GTCAAAGAAA
GAAATTTAAA ATTACACACT GCTCTGATTT ACAGTGATAG TAGTATAATC TAGTCCTTGA ACACCTAAGC TGTTAGTTAT
TACAAGTGTG AAGTTAGTTT TTGCATTACG GGTTAATGTG AAGACCAAAG CTCTGAAAAC ATCCTATGAA AAAAATAAGG
CATCTATGAA ATAGGTAAAA ATGTGATGAT ACTCTCGATG CTATCTGTCG ACTTTATGTT GTGAAATTGG ACTTACCAAT
AAAACTGGCT AGTGTTCTGA AATGGAGTAG TAGAACATAA GGGACTAATG ATATATTTTT CTTTATACAT CGACCTTAGG
TGGATGCTCT GCATTGTTTT TTTTTTCTTG CAGTTGTTTT CACCACATTT TAAGGAAGCA TTTTTCACTC TTGATGTCAC
AGGTTGGAAA GCAGATCGTT CTGGGCACGT TGGAAGATAA TTTCAAAGCT GACATGCTCT TGTCACTCTC AAGATTGGCA
TCCAAGTCAG TTCTTCTGTT TGGCGATCAG GTAGTGTAAT CCACTAGTTG GTAGCATATG TATTTGACTT AATTTGTTCT
AAACCATCAC TGCAATTATG TTCTGTGTTA CATAATTTAG TTCACTTTGC AATAATCATG TGTCTGTGTT TACTGTTTAT
ATTATACTCT CTTTGTTTGT GAATGCTTGG CACTTTATAA CCTGATTCAT GTTTTCTCAA ACCTCTGAAG AAACAATTAA
TGGCATCCCA TTTCCTCATG TCATTTCCTG TGATTGACAT GCTACTGAAA GATACCTTAG TGACATTATA AAAATTAGAT
ATGACAATCA AGAATCAGGT GATTCAAATT TCTTTTTGAG TTACTAGCTA TCTGTATTTG TTTACCCTCT TGCTGACAAG
CTGGGGTCAT TAATACCAAT GTTCTCTGTT CCCTTTGTGA ATTGATTTCG AAGTAAACTT TATTTCGATT TACTATTTCA
GGTGGAATTG CTGTTATTGT TCCTGGAGCA TGAATCTTCT CATTGCATGA AGACCGTGTC ATTGAAATGT TTATGTTTTA
TGTTTCACGG AAGCATCTGC CATTTTCCTG TTTTAAGGAC TGTTTTTGGA ACGTTATTAC AGCTAATTGA TGATGATGAT
TTCCCACTTG ATTGTAAGAG AGATGCATTT ACGGTTCTTC AAAAGGTGAA CACTAAGGTC TTCTGTTCGT GCTGTCTAGA
TATCTCTTTT TCCTCATTAT GATAGCTGAT TGATTTATAA AAACTTTTCA GATAGTCTGT GGCAAAGCTC CAATTGTTCA
TTTTGTCGAT ACTTCTGAGC TATCTAAGCT TGTTCTGGCT GCTGAGAGTT CTTTGCATTC TTCTTCCTGG GAGATGCAAG
GTACTGCTCT TAAAGTTATT GCTGGCACCT TATGTTGTCT TCAGCAAACA AGATCACATC AGAACATGAT TACTCAGGAA
GGTTCATCAT TGACTTACAA TGGGTGTCAA GGGATTACCA GCAACTTCCT GTCAACTCAT GTAGAAAATG ATGAGGACAA
ATTCGTGCAT AAGATTGTAA CATCAATGGT GAATCATAAT ATATCTCTGG TCAATCAAAT AATAAGCACT GGAAACAAGG
AAGCAACAAG GAGACATACT TATATGTCCT CTGAATTCAA GATGTACAGA TCTATGTTAA GCAGTATGCT AAAACTTCTT
GTGTGCTACC CCTTCTGCTG CTGCTGTTGC TCTTGATAAA CTAAGAGGCC TGATAAAAGA ACTAGCCCGA CTAGATGACA
GTGATTGCTC CAAAGTTTCT GTTGCCAATG TTGAATCATT TCAAACATAT TCTGCCCGTG AAGTACTTGG CACTTCAAAT
GATATTAAGC CAGAGACTGC TAGTGTGATG GCTTCTCACA TGGGAGCAGA TTTTGATAAG TTAAAATTCG ACCCAACTGA
ATTTAGTAGC AAGAAGGAAG TATTTATAGT GCGTAATATA ATTCTTTCGA CACTCAAGTT TGCAAATACT TGTCATAATA
TGCTTTCTAA AACTCCTGGT GCTAGCTGCA ATCTTTATGA TAGAATCAAG GAGCTGATTG AGTGTGTGCA GCAGAATGCT
TCTCAGTATT GTAGCACATA CGAATTTTTC CATCTGATAA TGTGTGCTTG TATTTCATGG TATGCTTGTA AAACTAGAGA
TGGCAATCAA GAATCAGGTG ATCCAACAGA ACAGCCTGAC ATATTCTCTA GTCCTTCTAT TTGGTTAACT CAGGAGCTCT
GTGCGATTCG GATAACAAAA ATGCTTTTCA GAAAGCAGAG GTATTGGGAT GCCTATATGT CTGCTATGTA CTGTTGTCGT
GAAGGCCTCT GGTTTGTGGT GTCGTTTGTC TTTAGAAAAC TTGCAGATGA TTTTGGGTCA GGCTCTTTCA GTTTTTGGTT
CAAATCATTG CTGCTTATTT CAGCTGGAGA AATTGAGATG AAGCTACTGC TTTTCCCTTC AGCAATCATT AAGTTGGTCA
GTGAGCTTAA AACAGATTGC GATCTTCATG AGAGTTTTTA CTGTGTTGAA ACAAATGTTG ACAGTAGTCT TGCTGGCTCT
TCAGAGTTGC ATGGTTCCCA AGCAAAGATT ACTGATATTT GCAGCAAAAC ATTCTTAGCT ACTGATCACC TCTTATCGAA
TACCTCTTCA AGTCATGAGC TGTTTTTCCA GAGGTGGTTT ATTAGTCTCA GGGCATCGTT TCTTGAGATC CTAGCAGATT
TTCTTGGTAT CCTTACTGCA CATTTAACTG ATCAGAGAGA TGAATCTCAT CATGATGCTA TTGGAGACCA TTCCAGTGTA
CCTAGAGAGC ATAATAACAG CCAATTACTT GCTTTGGTGA ATTGTTCATT ACGATTAAGT GAACTGGCAC ATAGTTATGA
TCTACTTGCT GTATCCCATG GGGACATGGA TCGCCAAAGT TTTTCTAGCA TAGCCAGGCT TGCTTTCATG TGCTCACTTC
TGGCATTTTG TATTGCATTT TCTGTGGATT TCTCAAAGGT ACATAGTAGT GTGGAGTCTT GCAGGCTTCC AGAGAGGTTT
TCTCACGCTT CAGTTGTACA AGATTTACAT GAAAGAGTGG ATAGGACTGA TAGCCAAATT GTTTCACAAC TGCAACAATT
AATGCCCATT TGTTGTGATA AAGTGCACTC CATACAGATT GTCACAAGAA TGAATTGTGA ATTGTTCAGG TATTCTGGAA
AAGGATTCTT ATCGTCTTTG CAAATTTGCT GTGGCATATT TCCTCCGCTT ACGTGGGGAC ACCAAAGGAA TAGCGACTGG
AGAGGACAGT GTATCTCCTT TGCATGGAGG GATGCAATTT CTGTCCAGCA TTTTACAGAG GGTTATGGAA TTGCCATTTG
TTCTACCCAA ATACTTCTTC AGAGTAAGGT AACGTATGCG TGTTGTTCTC TTAAAATTAG TTGTTGTGGA TGAGAAGTTC
ACCATGCTGG ATCACTTAAT TTTTTTTTCA CAAGCCACAT GTGCCTATTT AATACATAGA TGATCGCAGA GTTTTATTTT
ATGTATATCT CACTATTCCT CTCTGAAATT TGTGTTTCAG TAATGCATCG CTCGAATAGA TATCTGTAAT AATGGTTAGC
TTGTTTACTA TATATCTTGC AGGCCTTGCT TTGGTGCTGA ACTTCATATA TATGATTCAA ATCCAGAAAA CAGAGACGGG
ATATCAGTAC CAAGTGGCCT CCAGCTTTCC CTAACCCTTT GCTTGCAGTG GAAATGTGTG TTAGGAGTAA CATTGATATC
TCGAAGCTAC TCGAAGCTAT ACTGCGTTTT AGCTGCAAGC TCAGCATCCT GCTGCTTAGA TGCAACAGGA ACAAGAAGCA
AAGAGTTTGA GATACACAAG AAAACTGCTG GAATGGTTGG TCTTAATACC AAGCTGATGC AGTACATAGA GGATGATTTG
AGAAAGAAGA GGGAGAAGAA GAGGAAAAAG GTCCGTGTGG AGGAGAAGGA AATGGTGACA GCATTTGCGC GTTTCGAAGC
AAGTGACAGT GGGATGGGAT TCTCTAGCTA CCTGCTGGAT GTGTCTGAAT TTCCTCAAGG TTCATACAAG ATGAAGTGGC
ATGCGTGCTG CATCGACAAA GATGGCGCCT ATTATAGCTT GCTGCCTCTC AACGACGGCG CAGCCTTCTC CGTTCGCAAG
TCTTGACAGC CTTAGACATC TCTTGTTAAC TTATAATCGT CGCAACTAGA TTACTAGACT AGTGTTTTTG TATTTAGAGA
CAAACAAATT GCATTACAAC AAGACTTGTT AGTAGCATAT GTTTCATGCT G

Locus: Os01g0103700

Loading...

Locus: Os01g0103700

Loading...