Os01t0104200-00

Locus

Os01g0104200

Description

No apical meristem (NAM) protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC16

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 16

Oryzabase Gene Symbol Synonym(s)

ONAC016, ONAC16

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 016, NAC domain-containing protein 16

Transcript Evidence

ab initio prediction

Protein Evidence

A2ZNA6 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Expression Databases

TENOR (Os01t0104200-00)

Others

Oryzabase (15826)

Transcript

1020 bp

>Os01t0104200-00 No apical meristem (NAM) protein domain containing protein.
ATGACCATCGACCTGCAGCTTCCGGCGGCGGCGTGCGGTGATCATCacacagcagcaggg
gcagggctgccgccgggattccggttccacccgacggacgaggagctcctcctccactac
ctcggcaagcgcgccgcggcggcgccctgcccggcaccggtgatcgccgaggtggacatt
tacaagtacaacccgtgggagctgccggCCATGGCGGTGTTCGGGGAGTCGGATGGCgag
tggtacttcttcagcccacgcgaccgcaagtaccccaacggcgtccgtcccaaccgcgcc
gccggctccggctactggaaggccaccggaaccgacaagcccatctccatctcggagacg
cagcagacggtactgctgggcgtgaagaaggccctcgtcttctaccgcggtcgcccgccc
aagggcaccaagaccagctggatcatgcacgagtaccgcctCGCCAACGCCGCCGCCTCC
TCCTCCTCCTCCTATACTAGTAACATGAAGCAGCTGGCCTCATCATCATCGTCCAGCTCC
AGCAGCGCCAGCATGAGGCTGGACGAGTGGGTGCTGTGCAGAATCTACAAGAAGAAGGAG
GCCAACCAGCAGCTGCAGCACTACATCGACATGATGATGGACGACGACAACGATGACGAA
CACAACCTGCAGGTGCAGCAGCAGCAGCAGCAGCAGGCTCAAAGCCACCGGATGCCAAGG
CCTCCATCCATCTCAGACTACCTTCTCGACTACTCCGACGACCTCCCGCCGTCCACCGAT
CAGACGCCATCTCTGCACCTTGGATTCACGGCGGTGAACGAGGGCAACAACAAGAGGCAC
AAAACTATGGAGGAATATTATTCTATTTCCATTTCCACTGCAGATATGCTGCATGCGTCG
TCGTCCACGTCCAACAACAAGTCGACGCAAATCAACTTCTCCTCCATATTTGAGCCGCAG
ACGCCTGCAGCTGCGGGCCATCAGCTGATGTCTTCTCACAACGACGACACATCCATATGA

CDS

1020 bp

>Os01t0104200-00 No apical meristem (NAM) protein domain containing protein.
ATGACCATCGACCTGCAGCTTCCGGCGGCGGCGTGCGGTGATCATCacacagcagcaggg
gcagggctgccgccgggattccggttccacccgacggacgaggagctcctcctccactac
ctcggcaagcgcgccgcggcggcgccctgcccggcaccggtgatcgccgaggtggacatt
tacaagtacaacccgtgggagctgccggCCATGGCGGTGTTCGGGGAGTCGGATGGCgag
tggtacttcttcagcccacgcgaccgcaagtaccccaacggcgtccgtcccaaccgcgcc
gccggctccggctactggaaggccaccggaaccgacaagcccatctccatctcggagacg
cagcagacggtactgctgggcgtgaagaaggccctcgtcttctaccgcggtcgcccgccc
aagggcaccaagaccagctggatcatgcacgagtaccgcctCGCCAACGCCGCCGCCTCC
TCCTCCTCCTCCTATACTAGTAACATGAAGCAGCTGGCCTCATCATCATCGTCCAGCTCC
AGCAGCGCCAGCATGAGGCTGGACGAGTGGGTGCTGTGCAGAATCTACAAGAAGAAGGAG
GCCAACCAGCAGCTGCAGCACTACATCGACATGATGATGGACGACGACAACGATGACGAA
CACAACCTGCAGGTGCAGCAGCAGCAGCAGCAGCAGGCTCAAAGCCACCGGATGCCAAGG
CCTCCATCCATCTCAGACTACCTTCTCGACTACTCCGACGACCTCCCGCCGTCCACCGAT
CAGACGCCATCTCTGCACCTTGGATTCACGGCGGTGAACGAGGGCAACAACAAGAGGCAC
AAAACTATGGAGGAATATTATTCTATTTCCATTTCCACTGCAGATATGCTGCATGCGTCG
TCGTCCACGTCCAACAACAAGTCGACGCAAATCAACTTCTCCTCCATATTTGAGCCGCAG
ACGCCTGCAGCTGCGGGCCATCAGCTGATGTCTTCTCACAACGACGACACATCCATATGA

Protein

339 aa

>Os01t0104200-00 No apical meristem (NAM) protein domain containing protein.
MTIDLQLPAAACGDHHTAAGAGLPPGFRFHPTDEELLLHYLGKRAAAAPCPAPVIAEVDI
YKYNPWELPAMAVFGESDGEWYFFSPRDRKYPNGVRPNRAAGSGYWKATGTDKPISISET
QQTVLLGVKKALVFYRGRPPKGTKTSWIMHEYRLANAAASSSSSYTSNMKQLASSSSSSS
SSASMRLDEWVLCRIYKKKEANQQLQHYIDMMMDDDNDDEHNLQVQQQQQQQAQSHRMPR
PPSISDYLLDYSDDLPPSTDQTPSLHLGFTAVNEGNNKRHKTMEEYYSISISTADMLHAS
SSTSNNKSTQINFSSIFEPQTPAAAGHQLMSSHNDDTSI*

CDS

chr01:216212..216769 (+ strand) : 558 bp

chr01:216884..217345 (+ strand) : 462 bp

FASTA

>Os01t0104200-00 class=Sequence position=chr01:216212..217345 (+ strand)
ATGACCATCG ACCTGCAGCT TCCGGCGGCG GCGTGCGGTG ATCATCacac agcagcaggg gcagggctgc cgccgggatt
ccggttccac ccgacggacg aggagctcct cctccactac ctcggcaagc gcgccgcggc ggcgccctgc ccggcaccgg
tgatcgccga ggtggacatt tacaagtaca acccgtggga gctgccggCC ATGGCGGTGT TCGGGGAGTC GGATGGCgag
tggtacttct tcagcccacg cgaccgcaag taccccaacg gcgtccgtcc caaccgcgcc gccggctccg gctactggaa
ggccaccgga accgacaagc ccatctccat ctcggagacg cagcagacgg tactgctggg cgtgaagaag gccctcgtct
tctaccgcgg tcgcccgccc aagggcacca agaccagctg gatcatgcac gagtaccgcc tCGCCAACGC CGCCGCCTCC
TCCTCCTCCT CCTATACTAG TAACATGAAG CAGCTGGCCT CATCATCATC GTCCAGCTCC AGCAGCGCCA GCATGAGGGT
ACGTACGTGC TACGGTGCTA GTGCTAACTA CATATATATA TATCCTCTTC CATATACTCC ATCCACTGAT CGATATATAT
ATATGCGCAA TTATATTCAT GCGCGTACGC AGCTGGACGA GTGGGTGCTG TGCAGAATCT ACAAGAAGAA GGAGGCCAAC
CAGCAGCTGC AGCACTACAT CGACATGATG ATGGACGACG ACAACGATGA CGAACACAAC CTGCAGGTGC AGCAGCAGCA
GCAGCAGCAG GCTCAAAGCC ACCGGATGCC AAGGCCTCCA TCCATCTCAG ACTACCTTCT CGACTACTCC GACGACCTCC
CGCCGTCCAC CGATCAGACG CCATCTCTGC ACCTTGGATT CACGGCGGTG AACGAGGGCA ACAACAAGAG GCACAAAACT
ATGGAGGAAT ATTATTCTAT TTCCATTTCC ACTGCAGATA TGCTGCATGC GTCGTCGTCC ACGTCCAACA ACAAGTCGAC
GCAAATCAAC TTCTCCTCCA TATTTGAGCC GCAGACGCCT GCAGCTGCGG GCCATCAGCT GATGTCTTCT CACAACGACG
ACACATCCAT ATGA

Locus: Os01g0104200

Loading...

Locus: Os01g0104200

Loading...