Os01t0106900-02

Locus

Os01g0106900

Description

Similar to 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDXR, DXR, OsIspC, IspC

Oryzabase Gene Name Synonym(s)

1-deoxy-D-xylulose 5-phosphate reductoisomerase, DXP reductoisomerase, deoxyxylulose 5-phosphate reductoisomerase

Transcript Evidence

AK059692 (DDBJ, Best hit)

Protein Evidence

Q8W250 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: isoprenoid biosynthetic process (GO:0008299)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: protein binding (GO:0005515)

Molecular Function: 1-deoxy-D-xylulose-5-phosphate reductoisomerase activity (GO:0030604)

Molecular Function: metal ion binding (GO:0046872)

Molecular Function: NADPH binding (GO:0070402)

Functional domain (InterPro)

1-deoxy-D-xylulose 5-phosphate reductoisomerase (IPR003821)

1-deoxy-D-xylulose 5-phosphate reductoisomerase, N-terminal (IPR013512)

1-deoxy-D-xylulose 5-phosphate reductoisomerase, C-terminal (IPR013644)

NAD(P)-binding domain (IPR016040)

Full-length cDNA

001-032-B08 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0106900-02)

RiceXPro (AK059692)

Others

Oryzabase (14685)

KEGG (Os01t0106900-02 (EC:1.1.1.267))

Transcript

1696 bp

>Os01t0106900-02 Similar to 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Fragment).
ATCCCGACCAGACGTCGAGTCGAGCATTAACTCAGTCAGGGTGGCCATGGCGCTCAAGGT
CGTCTCTTTCCCCGGGGACTTGGCCGCGGTCTCATTCCTCGACTCCAACAGAGGAGGAGC
TTTCAACCAGCTCAAAGTGGACCTCCCGTTTCAAACGAGGGACAGAAGAGCAGTTTCCCT
GAGAAGGACTTGCTGTTCAATGCAACAGGCTCCACCACCAGCATGGCCTGGTCGAGCCGT
TGTTGAACCTGGGAGGAGGTCATGGGATGGCCCCAAGCCTATCTCAATTGTTGGCTCAAC
CGGTTCTATTGGCACACAGACATTGGACATAGTTGCGGAGAATCCAGATAAATTCCGGGT
TGTTGCTCTTGCTGCTGGCTCCAATGTGACTCTTCTAGCTGATCAGGTGAAAACATTCAA
ACCAAAGCTTGTTGCTGTAAGAAATGAGTCATTAGTTGATGAGCTAAAGGAAGCCTTAGC
TGATTGTGATTGGAAGCCAGAAATTATTCCTGGTGAGCAAGGTGTCATAGAGGTTGCTCG
CCACCCAGATGCAGTTACAGTTGTTACTGGGATAGTAGGGTGTGCAGGACTGAAGCCTAC
AGTTGCTGCAATTGAAGCTGGGAAAGATATAGCATTGGCGAACAAAGAGACACTTATTGC
AGGTGGTCCTTTTGTGCTTCCCCTTGCACAAAAGCACAAAGTGAAAATACTTCCTGCTGA
TTCTGAGCACTCTGCTATATTTCAGTGTATACAAGGCTTGCCCGAAGGAGCACTTCGCCG
CATTATTTTGACTGCATCAGGTGGTGCTTTCAGGGACTGGCCAGTTGACAAGTTGAAAGA
AGTAAAAGTTGCTGATGCTTTAAAGCACCCGAACTGGAATATGGGGAAGAAGATTACTGT
AGATTCTGCTACATTATTCAACAAGGGTTTAGAAGTTATTGAAGCACATTATTTATTTGG
TGCTGAATACGATGACATTGAAATTGTGATCCACCCACAATCTATCATACACTCTATGAT
TGAAACCCAGGATTCATCTGTGTTGGCTCAACTGGGATGGCCAGATATGCGGATACCAAT
CTTATACACCATGTCTTGGCCAGACAGAATCTATTGCTCAGAGGTCACCTGGCCCCGACT
AGATCTTTGCAAGCTGGGTTCACTGACATTCAAAGCTCCTGACAATGTGAAATACCCGTC
GATGGATCTCGCCTATGCAGCTGGAAGAGCTGGGGGCACCATGACAGGAGTTCTGAGTGC
TGCTAATGAGAAGGCTGTGGAGTTGTTCATCGATGAAAAGATCGGGTACCTGGACATCTT
CAAGGTGGTGGAGCTGACATGCGACGCTCATCGGAATGAGCTAGTAACAAGGCCATCACT
GGAGGAGATCATACATTATGATCTGTGGGCGAGGGAGTATGCTGCCAGCCTACAGCCATC
CACTGGCCTCAGCCCTGTACCTGTCTAGTACTTGTAGCAATACAAAATTACAGTAGCATT
GTACACTACTGCCGTGCCAGCTCCATGCATAGTCAGCAGCTGGCCACTCTCTAGCTATAT
CTAGATGCGAGAGAATTTTAAGGATGTAAATCATGCCTTCACATGAATAAATCGTTCGTC
CGTGCGTTGTGTATTCATGTAAATTTTGACGGATGGTCAAGTAAAAATAACAATGGCAAA
TTAATTTAGGGAAGAA

CDS

1422 bp

>Os01t0106900-02 Similar to 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Fragment).
ATGGCGCTCAAGGTCGTCTCTTTCCCCGGGGACTTGGCCGCGGTCTCATTCCTCGACTCC
AACAGAGGAGGAGCTTTCAACCAGCTCAAAGTGGACCTCCCGTTTCAAACGAGGGACAGA
AGAGCAGTTTCCCTGAGAAGGACTTGCTGTTCAATGCAACAGGCTCCACCACCAGCATGG
CCTGGTCGAGCCGTTGTTGAACCTGGGAGGAGGTCATGGGATGGCCCCAAGCCTATCTCA
ATTGTTGGCTCAACCGGTTCTATTGGCACACAGACATTGGACATAGTTGCGGAGAATCCA
GATAAATTCCGGGTTGTTGCTCTTGCTGCTGGCTCCAATGTGACTCTTCTAGCTGATCAG
GTGAAAACATTCAAACCAAAGCTTGTTGCTGTAAGAAATGAGTCATTAGTTGATGAGCTA
AAGGAAGCCTTAGCTGATTGTGATTGGAAGCCAGAAATTATTCCTGGTGAGCAAGGTGTC
ATAGAGGTTGCTCGCCACCCAGATGCAGTTACAGTTGTTACTGGGATAGTAGGGTGTGCA
GGACTGAAGCCTACAGTTGCTGCAATTGAAGCTGGGAAAGATATAGCATTGGCGAACAAA
GAGACACTTATTGCAGGTGGTCCTTTTGTGCTTCCCCTTGCACAAAAGCACAAAGTGAAA
ATACTTCCTGCTGATTCTGAGCACTCTGCTATATTTCAGTGTATACAAGGCTTGCCCGAA
GGAGCACTTCGCCGCATTATTTTGACTGCATCAGGTGGTGCTTTCAGGGACTGGCCAGTT
GACAAGTTGAAAGAAGTAAAAGTTGCTGATGCTTTAAAGCACCCGAACTGGAATATGGGG
AAGAAGATTACTGTAGATTCTGCTACATTATTCAACAAGGGTTTAGAAGTTATTGAAGCA
CATTATTTATTTGGTGCTGAATACGATGACATTGAAATTGTGATCCACCCACAATCTATC
ATACACTCTATGATTGAAACCCAGGATTCATCTGTGTTGGCTCAACTGGGATGGCCAGAT
ATGCGGATACCAATCTTATACACCATGTCTTGGCCAGACAGAATCTATTGCTCAGAGGTC
ACCTGGCCCCGACTAGATCTTTGCAAGCTGGGTTCACTGACATTCAAAGCTCCTGACAAT
GTGAAATACCCGTCGATGGATCTCGCCTATGCAGCTGGAAGAGCTGGGGGCACCATGACA
GGAGTTCTGAGTGCTGCTAATGAGAAGGCTGTGGAGTTGTTCATCGATGAAAAGATCGGG
TACCTGGACATCTTCAAGGTGGTGGAGCTGACATGCGACGCTCATCGGAATGAGCTAGTA
ACAAGGCCATCACTGGAGGAGATCATACATTATGATCTGTGGGCGAGGGAGTATGCTGCC
AGCCTACAGCCATCCACTGGCCTCAGCCCTGTACCTGTCTAG

Protein

473 aa

>Os01t0106900-02 Similar to 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Fragment).
MALKVVSFPGDLAAVSFLDSNRGGAFNQLKVDLPFQTRDRRAVSLRRTCCSMQQAPPPAW
PGRAVVEPGRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQ
VKTFKPKLVAVRNESLVDELKEALADCDWKPEIIPGEQGVIEVARHPDAVTVVTGIVGCA
GLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHKVKILPADSEHSAIFQCIQGLPE
GALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEA
HYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRIPILYTMSWPDRIYCSEV
TWPRLDLCKLGSLTFKAPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVELFIDEKIG
YLDIFKVVELTCDAHRNELVTRPSLEEIIHYDLWAREYAASLQPSTGLSPVPV*

5'UTR

chr01:380489..380534 (- strand) : 46 bp

CDS

chr01:380398..380488 (- strand) : 91 bp

chr01:379206..379387 (- strand) : 182 bp

chr01:378841..378927 (- strand) : 87 bp

chr01:378616..378741 (- strand) : 126 bp

chr01:378471..378533 (- strand) : 63 bp

chr01:377617..377766 (- strand) : 150 bp

chr01:377314..377381 (- strand) : 68 bp

chr01:377123..377234 (- strand) : 112 bp

chr01:376938..377042 (- strand) : 105 bp

chr01:376647..376768 (- strand) : 122 bp

chr01:376003..376149 (- strand) : 147 bp

chr01:374980..375148 (- strand) : 169 bp

3'UTR

chr01:374752..374979 (- strand) : 228 bp

FASTA

>Os01t0106900-02 class=Sequence position=chr01:374752..380534 (- strand)
ATCCCGACCA GACGTCGAGT CGAGCATTAA CTCAGTCAGG GTGGCCATGG CGCTCAAGGT CGTCTCTTTC CCCGGGGACT
TGGCCGCGGT CTCATTCCTC GACTCCAACA GAGGAGGAGC TTTCAACCAG CTCAAAGGTT GGATCTTTTC CTCTTTCTTA
TCCCCTTCCG GATCAACTTT ACTGCTCTTT CTTGTTTCTT GGCCCTCGAC TTGCTTCTGT TTTCCTCTCA TCTTGTTTAG
ACTTCATTTC GTCTGTTTAG CCTGTTTCAA GATAATCCGC AGTGTGTTCA AAGAGCACCC ATTCCTGGTG CCGATTAAAT
TAGGCACTTC TACTCACTCG ACACAGCCGG CACCCATGCT GTGAGTGGGA TTAGGAAAGC TGCTGCTTTT GCAAGGATTT
ATGCCACAAT TTTGGTTTGG ATTGCTTGGG CTAAAATAAA ATTGGTCTTC GTTCTCACAG TGCATGGGAA TGGCAGCTTC
TGAGTTCTGG AGAACATAGA CACACAGTCA TTGTAAAGTT GCAAACTCTG TGCCTTAACT GTTTTGATTT TGACATCTGA
AAAGGTGGAA TTTCCCCGGT TCGCAGAAAA AAAAGGGGTC TGAATTCATT TCTTTGAGAT TAAAAACGGG TTCAGATTTT
TCTCTTATAC GGGTATAAGA CACAATTCTT CCAGAATTTA TGCAACTTCC TCTTGGTCGA GAATTATGCT GTTGTCAGTA
TTACGTGTCT AGAATCGAAC CCCTTTTTGT AATCAACTGG GTGGATTAAA TTCTGAAATA TCTGAGCATT ATCTTCATGC
TTGCAACTTC TATCTTTGGA ATATCTAGTG TTCTGAGAAT ATATTCTGCA TAGATTCCAA TTCAGTTTCT ACTTTCTAGT
GATATGGTTC TATTCAGATG AGTTGCACTA CTGTAACGTG CTTTTACTCT AAATTGCTTG GTGCACATGA AACACGCAGT
CTGCCAAATT GTCAAGATCG GCCTCAATTA GCTCAGGCCT CAGGACTATT TTTTTTTTCT GCCATGTTTC TTGAGCATAT
TGCAGCAAAC GAGTTAGCAG AGAGTTGTAG GCACGTATAT ATGCCTGAAC ATTGATTACT AGTACTATTT TCATTCATAT
ATCTTAATTT GGCTGTCTTT ATTGCAGTGG ACCTCCCGTT TCAAACGAGG GACAGAAGAG CAGTTTCCCT GAGAAGGACT
TGCTGTTCAA TGCAACAGGC TCCACCACCA GCATGGCCTG GTCGAGCCGT TGTTGAACCT GGGAGGAGGT CATGGGATGG
CCCCAAGCCT ATCTCAATTG TTGGCTCAAC CGGTTCTATT GGCACACAGG TAAATGGAAC ATCAAGATCT AAGATTAACG
GATGGAAATT AATACTCCAT ACCTTTTTTA TATCTGTCAG TTGTGCTAGT ACATCAATGT TTGGTCAATT AGTTCATCTA
AGAGTAAATG TTTGACCTAT TTATCTGATG ATACGAGTTG ACCCTTTCAA GATCAATCAA CATGTCTTGA GCTATTCATT
GAAATTAGTT GGACATGAAA ATGCGACGTT TATATTCTGT GGTACTAATA GTGTTTTATC TTTTCTTTTC TTTGCATAAC
TAAAAAGACA TTGGACATAG TTGCGGAGAA TCCAGATAAA TTCCGGGTTG TTGCTCTTGC TGCTGGCTCC AATGTGACTC
TTCTAGCTGA TCAGGTATAA TGATTTTGTG AGGAAAATAT CCCTTCTTTC GACCTTTCAT GGTAGGATTA TGGACATGAA
AGTTAACTGA ATATAGGTTG TTTAACTAAG CAGGTGAAAA CATTCAAACC AAAGCTTGTT GCTGTAAGAA ATGAGTCATT
AGTTGATGAG CTAAAGGAAG CCTTAGCTGA TTGTGATTGG AAGCCAGAAA TTATTCCTGG TGAGCAAGGT GTCATAGAGG
TGAGTTTTTC ATGTCATATT TATGTTTAAA TAGCTGATGC TTTGCTGTGA ATTTTATAAA GATTCAACTC TCATATAATA
GGTTGCTCGC CACCCAGATG CAGTTACAGT TGTTACTGGG ATAGTAGGGT GTGCAGGACT GAAGGTAATC TTTCTTTTTA
TATTGCATAT TCTTTGCTCT GCTTCCTTTA ATATTAGGTG TTAATATTAC AAAAACTCAA TTATTTCTTT GATGTTTCAA
CAAGTATATT CAAGAATTTA TTGAGAAAGA AATGAAAATA TATGTGCTTG AAAATTATAT TCCCAGTGTT ATATTACCAT
AACAACAGGC CATTTTAAAC ATATAGTACT GAAACACTTG GAATACATAC GTTATTATGG TTACATGAAT GTACTTGCAA
TTTTTCAAGG CGAGTATGTT TGAATTGGAA GAGCTCATGC CAAAACAGTC CTTTTGTAGA GTTGCTGATT ATCTACTCAA
AAGTGTCTAG CAATTTGAGA TTTTTTTTAA TAGAGTTCTG ATGCACCAAA AAATAAAGTT TGATATGCAA CAACTAAAAC
GGTAGTGGTA CATATATCCT ATTCTTATCT TGTAGAACAT TCGTGCATGG ACCGTTTTGT ATATCAGGTC ACCCATCATA
CCTTGATGAT GCTACTTTTA GACTACTCAA TATCTTGATC TTCTTTTTGG TACTTATTTC TTAAAAGTTT GATTTATCTA
GACGAATGAG TTGTGTAGCC AAACGAAAGA ATTGAATGCT TGCTGAAGTT CTGTATGCAT GCAAACTACA TTACCAGAAT
CTGGCACCAC TTGCTGATTT GCCTACTTAA ATTTCTTTGC TCTGCCAGCC TACAGTTGCT GCAATTGAAG CTGGGAAAGA
TATAGCATTG GCGAACAAAG AGACACTTAT TGCAGGTGGT CCTTTTGTGC TTCCCCTTGC ACAAAAGCAC AAAGTGAAAA
TACTTCCTGC TGATTCTGAG CACTCTGCTA TATTTCAGGT ACCACAGAAA ATAAATTACC TGTAACTAAT TTTACTTGGT
TCATCTGATA TAAGTTTGGT GTAAGGTTGT GATAGTCTGG TACGTACTCA ACGTTGCCTG TTCAAAAACC TCTTATACAC
TAGTGGCTTT ATCTTTAACA CTTAAACAAA GTAGCAGTAA GATGTATGTT GCTTGTTATA GTTTACTGTT GTTCTATTAT
ATGCTGATTT GCAGTTTCCC TCTACTATCA TAGTGTATAC AAGGCTTGCC CGAAGGAGCA CTTCGCCGCA TTATTTTGAC
TGCATCAGGT GGTGCTTTCA GGTAAATCTA CTGACATACA TGTTATATAT GTTTTTCTAC TGGACATTGG ACTCCATCTT
ATATCCATTG ATGATGTCAG GGACTGGCCA GTTGACAAGT TGAAAGAAGT AAAAGTTGCT GATGCTTTAA AGCACCCGAA
CTGGAATATG GGGAAGAAGA TTACTGTAGA TTCTGCTACA TTATTCAACA AGGTGTTTGC AGTAAACTTT CAGAATTTTA
CTGAGGTCAT GTTGGCAGTA TTTGCACTAA AATGATCACT TGATTCATAC AGGGTTTAGA AGTTATTGAA GCACATTATT
TATTTGGTGC TGAATACGAT GACATTGAAA TTGTGATCCA CCCACAATCT ATCATACACT CTATGATTGA AACCCAGGTG
AGTCCTACAG CACAGCTATG GAAAATGTTT AGCGGTTATG CTCAACTGCA GTGGATTTTA AACTGTTAAT GCATGCACAC
TTAATCCTGA TATGGCAACC GTATTTTCAT GTTTACGTTT GGCTTAATAT TTTTTTTCAA GTATTCATGA AGTTCTGTTT
CTCCAGGATT CATCTGTGTT GGCTCAACTG GGATGGCCAG ATATGCGGAT ACCAATCTTA TACACCATGT CTTGGCCAGA
CAGAATCTAT TGCTCAGAGG TCACCTGGCC CCGACTAGAT CTTTGCAAGT ACAGGCTCTT CCCTTAAATG CTGTGCTACT
TTTGCATTAC CACTGATAAT TTTGTTCGAG AATGACCTCA AAGAATTTTA GCTTTCTTAT TGTTATCGCA TGGTTCTCTC
ATAGCCCACT CAGATTATCA GTAAGCTTGA GCAGCCATCC TATAACAGTT AATATGTGGA TCTACTCTAC TTAAATTCAA
TGAAGCTCGT ATCGAACCTT CATACAAAGT TCAATGGATC GATTAAGTCC CTTTTGGCTG GTTGGTTACC AGTGATACGC
AAGTAGTTAA CGCTTGTAAT GAATTATGCT TTGGTTGTTA GGCATGAACG CTGCTTCATG TTACTAGCTA TATTTTGGGA
CGAAGGGAGT AGTAATAAAT TTAAAGAATA AAAGGTTAAT AAAGTAAAAG AACTAGATGC AACAAAAAAT TGTTAAGTTA
TAGTACTTAA CCGTGAAGAC CTTTTTTCAT TGCACGAAGG GTTAATTTTT AATTTGATAA TGCAGGCTGG GTTCACTGAC
ATTCAAAGCT CCTGACAATG TGAAATACCC GTCGATGGAT CTCGCCTATG CAGCTGGAAG AGCTGGGGGC ACCATGACAG
GAGTTCTGAG TGCTGCTAAT GAGAAGGCTG TGGAGTTGTT CATCGATGAA AAGTATGACA CTCATCATCA TCCCTTTTCC
TCTTTCCATT GCATAGTGGA TTCCATCGTC TGATTTTGTT TACGCACCTA TTCTCTGCAA TTTTAAAGGA GAATTATGTC
CTGCTGATTG CAGCAATGCA GCAAAACGAA TAACTGGTAT CTACCAAAGT CCATAGATAT CTCTTGCCCT TTGGAAAGTG
AGAGCTGAAA GGAGAGAGCA TACATGTCGT CAAAGCTAAT ATTCTCCGGC ACTTTCTGAG CCTTAAGATA TATCATGGAT
TATAATAAAC CGACAACATC TTGATTGATG CTAGTAGGCC TGTTTATATA TTGTAACTTG CTAGCTTAGC TGGGGGCTAC
CTATTGTTGT GAATGCCATG CTGTAGCCAT GAGAAGTTGA AAAGAGAACA CATGTCCTTA AAGCTTAAAT ATTCTCAGAC
ACTTTCTGAG CCTTAATATC TATCATGGAT CGTAAAAAAC CAGCAACGTC TCAATTTATG CTAGTAGTAA AAGGCCTGAT
TAAACCTTGG AGCTTAGCTG GGGTACCTGT TCTTGCACTG TAGCCATCAG AAGGTAAGGT ACCTGTTCTT GCACTGTCAG
AAGGTAAGGT ACCTGTTCTT GCACTGTAGC CATCAGAAGG TAAGTACCAA AATGGTATCC ATTGGTGCAA AATAAAAGGT
TTGTTTTTGT CGAAGGGCGA ATTGTTTTCT AAATGGTGAA TGGCTGACAA AACTTCATTG CAAGTTATTT AAACTGGTGA
ATTAATGTTT CCGCGGCTAT TTCTTTGCAA GTAGACATTT TCCCGTCAGA TAAACTTTAC ATATATATAA GCAAATGAAT
AGATGATTGT GGTTATGTTT TTGCAGGATC GGGTACCTGG ACATCTTCAA GGTGGTGGAG CTGACATGCG ACGCTCATCG
GAATGAGCTA GTAACAAGGC CATCACTGGA GGAGATCATA CATTATGATC TGTGGGCGAG GGAGTATGCT GCCAGCCTAC
AGCCATCCAC TGGCCTCAGC CCTGTACCTG TCTAGTACTT GTAGCAATAC AAAATTACAG TAGCATTGTA CACTACTGCC
GTGCCAGCTC CATGCATAGT CAGCAGCTGG CCACTCTCTA GCTATATCTA GATGCGAGAG AATTTTAAGG ATGTAAATCA
TGCCTTCACA TGAATAAATC GTTCGTCCGT GCGTTGTGTA TTCATGTAAA TTTTGACGGA TGGTCAAGTA AAAATAACAA
TGGCAAATTA ATTTAGGGAA GAA

Locus: Os01g0106900

Loading...

Locus: Os01g0106900

Loading...